Recombinant Full Length Bacitracin Transport Permease Protein Bcrc(Bcrc) Protein, His-Tagged
Cat.No. : | RFL18236BF |
Product Overview : | Recombinant Full Length Bacitracin transport permease protein BcrC(bcrC) Protein (P42334) (1-203aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus licheniformis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-203) |
Form : | Lyophilized powder |
AA Sequence : | MSFSELNIDAFRFINDLGKEYSMLNPVVYFLAEYMMYFLALGLVVYWLTRTTKNRLMVIY AVIAFVVAEILGKIMGSLHSNYQPFATLPNVNKLIEHEIDNSFPSDHTILFFSIGFLIFL FHKKTGWLWLVLAFAVGISRIWSGVHYPLDVAAGALLGVLSALFVFWTAPKLSFIHQMLS LYEKVEQRIVPSKNKSNDKSKNF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bcrC |
Synonyms | bcrC; Bacitracin transport permease protein BcrC |
UniProt ID | P42334 |
◆ Recombinant Proteins | ||
Tfrc-4532M | Recombinant Mouse Tfrc protein, His-tagged | +Inquiry |
RNF121-14291M | Recombinant Mouse RNF121 Protein | +Inquiry |
ALS3-2175Y | Recombinant Yeast ALS3 Protein (918-1119 aa), His-B2M-Myc-tagged | +Inquiry |
MRPL16-3764R | Recombinant Rat MRPL16 Protein | +Inquiry |
Rpp40-186R | Recombinant Rat Rpp40 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Prothrombin-93H | Native Human Prothrombin | +Inquiry |
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
Progesterone-01H | Native Human Progesterone | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
Y. enterocolitica-31 | Native Yersinia enterocolitica O:9 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAFAH2-3466HCL | Recombinant Human PAFAH2 293 Cell Lysate | +Inquiry |
RGS6-2370HCL | Recombinant Human RGS6 293 Cell Lysate | +Inquiry |
EAPP-6738HCL | Recombinant Human EAPP 293 Cell Lysate | +Inquiry |
PLAG1-3134HCL | Recombinant Human PLAG1 293 Cell Lysate | +Inquiry |
SLC39A11-1724HCL | Recombinant Human SLC39A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All bcrC Products
Required fields are marked with *
My Review for All bcrC Products
Required fields are marked with *
0
Inquiry Basket