Recombinant Full Length Bacillus Thuringiensis Upf0754 Membrane Protein Balh_0780 (Balh_0780) Protein, His-Tagged
Cat.No. : | RFL12553BF |
Product Overview : | Recombinant Full Length Bacillus thuringiensis UPF0754 membrane protein BALH_0780 (BALH_0780) Protein (A0RAB3) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus thuringiensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MNIWLSMLTTTGLGAIIGGFTNHLAIKMLFRPHRPMYIGKFQVPFTPGLIPKRRDELAVQ LGKMVVEHLLTPEGIGKKLTNEEFQKGLIHWAQVEVDKVMTNEQSLRHMLEKWDVAHVEK EATEKIEQVIIEKIEAFLEEYYTYTWEQALPHSVHEKIENAIPNVSAFILKRATHFFESE EGKSRLSKMIDDFFASRGALLNLVGMFLGNVSVVDRVQPEVIKFLGQDGTKQLLTDVLQK EWEKLKGRDVKELETFVEKEMIASSILSAVQVEETVGKFLNQSVQQVCEPVRETIIEKVV PGAVTKGLEWGAKNVESILNNLHLAEIVQQEVSTFSTERLEDLVLSITKNELKMITYLGA LLGGMIGIVQGLLLLFLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BALH_0780 |
Synonyms | BALH_0780; UPF0754 membrane protein BALH_0780 |
UniProt ID | A0RAB3 |
◆ Recombinant Proteins | ||
FGFR4-8839C | Active Recombinant Rhesus FGFR4 protein, Fc-tagged | +Inquiry |
TMED4-181H | Recombinant Human TMED4, Fc-tagged | +Inquiry |
NPY5R-3716R | Recombinant Rat NPY5R Protein, His (Fc)-Avi-tagged | +Inquiry |
SCEL-2022H | Recombinant Human SCEL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Saa4-3920M | Recombinant Mouse Saa4 protein(19-130aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
MFGE8-289B | Native MFG-E8 | +Inquiry |
Plg-297M | Active Native Mouse Plasmin | +Inquiry |
Rectum-024H | Human Rectum Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR12-355HCL | Recombinant Human WDR12 293 Cell Lysate | +Inquiry |
TM4SF1-667HCL | Recombinant Human TM4SF1 lysate | +Inquiry |
PSME1-2742HCL | Recombinant Human PSME1 293 Cell Lysate | +Inquiry |
CD6-958RCL | Recombinant Rat CD6 cell lysate | +Inquiry |
MED15-4392HCL | Recombinant Human MED15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BALH_0780 Products
Required fields are marked with *
My Review for All BALH_0780 Products
Required fields are marked with *
0
Inquiry Basket