Recombinant Full Length Bacillus Thuringiensis Upf0421 Protein Balh_2468 (Balh_2468) Protein, His-Tagged
Cat.No. : | RFL31519BF |
Product Overview : | Recombinant Full Length Bacillus thuringiensis UPF0421 protein BALH_2468 (BALH_2468) Protein (A0REW2) (1-355aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus thuringiensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-355) |
Form : | Lyophilized powder |
AA Sequence : | MNQVRKWNIIGGRVIKTGIAVFLTVLVCEFFNIPTIFAVITAIVTIEPTATDSIKKGLVR FPASTIGSAYAMTFTFFLGHQALSYALAAMFTIVTCQKLRLHAGTLVATLTAVAMIPITA DHYFTAFLIRLATTSTGIIVSTVVNFFILPPHYVKTISGCTEELFVKTANVMEEWLTALM DGKVIKKETTYNLSKLTVLLHKAVQFVQYEQKDWKYHRHTKKEMRSFLLVQKQLHLLQQI IYHIDNLARAPIETCDWSQNEKEILRRTIHSIISILRNYCEKIDEEHFKLIDELDKQFWT NKNDLAHCKPNQYHHHFSSESIILFEVLSIHDMLEELKQIFEKYESENQLNCSVH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BALH_2468 |
Synonyms | BALH_2468; UPF0421 protein BALH_2468 |
UniProt ID | A0REW2 |
◆ Recombinant Proteins | ||
ACE2-2452H | Recombinant Human ACE2 protein, His-tagged | +Inquiry |
Manbal-3917M | Recombinant Mouse Manbal Protein, Myc/DDK-tagged | +Inquiry |
IL9-67H | Recombinant Human IL9 protein | +Inquiry |
AQP7-1826M | Recombinant Mouse AQP7 Protein | +Inquiry |
Dld-5631R | Recombinant Rat Dld protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Complement C1s-44H | Native Human Complement C1s | +Inquiry |
Tnnt3-7424M | Native Mouse Tnnt3 Protein | +Inquiry |
F9-26523TH | Native Human F9 | +Inquiry |
calc1-8308S | Native Salmon calc1 | +Inquiry |
ALPP-8347H | Native Human ALPP | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF2BP1-5265HCL | Recombinant Human IGF2BP1 293 Cell Lysate | +Inquiry |
BMPR1A-2145HCL | Recombinant Human BMPR1A cell lysate | +Inquiry |
AKAP8-46HCL | Recombinant Human AKAP8 cell lysate | +Inquiry |
MPP2-4232HCL | Recombinant Human MPP2 293 Cell Lysate | +Inquiry |
MGAT3-1087HCL | Recombinant Human MGAT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BALH_2468 Products
Required fields are marked with *
My Review for All BALH_2468 Products
Required fields are marked with *
0
Inquiry Basket