Recombinant Full Length Bacillus Subtilis Upf0410 Protein Ydas(Ydas) Protein, His-Tagged
Cat.No. : | RFL36889BF |
Product Overview : | Recombinant Full Length Bacillus subtilis UPF0410 protein ydaS(ydaS) Protein (P96594) (1-85aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-85) |
Form : | Lyophilized powder |
AA Sequence : | MLSFLVSLVVAIVIGLIGSAIVGNRLPGGIFGSMIAGLIGAWIGHGLLGTWGPSLAGFAI FPAIIGAAIFVFLLGLIFRGLRKEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ydaS |
Synonyms | ydaS; BSU04370; UPF0410 protein YdaS |
UniProt ID | P96594 |
◆ Native Proteins | ||
VZV-04 | Native Varicella Zoster Virus (VZV) Antigen | +Inquiry |
Fibronectin-49H | Native Hamster Fibronectin | +Inquiry |
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
IgG1-014M | Native Mouse IgG1 Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
F10-63H | Native Human Factor X | +Inquiry |
◆ Cell & Tissue Lysates | ||
NID1-3829HCL | Recombinant Human NID1 293 Cell Lysate | +Inquiry |
EPHA3-001MCL | Recombinant Mouse EPHA3 cell lysate | +Inquiry |
MRPL12-4197HCL | Recombinant Human MRPL12 293 Cell Lysate | +Inquiry |
MAG-1315HCL | Recombinant Human MAG cell lysate | +Inquiry |
Liver-296R | Rat Liver Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ydaS Products
Required fields are marked with *
My Review for All ydaS Products
Required fields are marked with *
0
Inquiry Basket