Recombinant Full Length Bacillus Subtilis Upf0365 Protein Yqfa(Yqfa) Protein, His-Tagged
Cat.No. : | RFL10168BF |
Product Overview : | Recombinant Full Length Bacillus subtilis UPF0365 protein yqfA(yqfA) Protein (P54466) (1-331aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-331) |
Form : | Lyophilized powder |
AA Sequence : | MDPSTLMILAIVAVAIIVLAVFFTFVPVMLWISALAAGVKISIFTLVGMRLRRVIPNRVV NPLIKAHKAGLNVGTNQLESHYLAGGNVDRVVNALIAAQRANIELTFERCAAIDLAGRDV LEAVQMSVNPKVIETPFIAGVAMDGIEVKAKARITVRANIERLVGGAGEETIVARVGEGI VSTIGSSDNHKKVLENPDMISQTVLGKGLDSGTAFEILSIDIADVDIGKNIGAILQTDQA EADKNIAQAKAEERRAMAVAQEQEMRARVEEMRAKVVEAEAEVPLAMAEALREGNIGVMD YMNIKNIDADTEMRDSFGKLTKDPSDEDRKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yqfA |
Synonyms | floA; yqfA; BSU25380; Flotillin-like protein FloA |
UniProt ID | P54466 |
◆ Recombinant Proteins | ||
EPO-2861C | Recombinant Cynomolgus monkey EPO protein, His-SUMO-tagged | +Inquiry |
HAVCR2-529MAF555 | Recombinant Mouse Havcr2 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
OR52J3-1843H | Recombinant Human OR52J3 | +Inquiry |
B2m & Fcgrt-054M | Recombinant Mouse B2m & Fcgrt protein, His-Avi-tagged | +Inquiry |
DPH2-2839H | Recombinant Human DPH2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
FGA-42D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
Chitosan-003C | Native Crawfish Chitosan Water Soluble | +Inquiry |
C3b-06M | Native Mouse C3b Protein | +Inquiry |
LDHA-26867TH | Native Human LDHA | +Inquiry |
FSHB-P051H | Native Human Follicle Stimulating Hormone therapeutic protein(Urofollitropin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIT-001HCL | Recombinant Human KIT cell lysate | +Inquiry |
PLEKHB1-485HCL | Recombinant Human PLEKHB1 lysate | +Inquiry |
FGD2-6254HCL | Recombinant Human FGD2 293 Cell Lysate | +Inquiry |
PEX11G-3294HCL | Recombinant Human PEX11G 293 Cell Lysate | +Inquiry |
KLRK1-002HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yqfA Products
Required fields are marked with *
My Review for All yqfA Products
Required fields are marked with *
0
Inquiry Basket