Recombinant Full Length Bacillus Subtilis Upf0053 Protein Yhdp(Yhdp) Protein, His-Tagged
Cat.No. : | RFL32857BF |
Product Overview : | Recombinant Full Length Bacillus subtilis UPF0053 protein yhdP(yhdP) Protein (O07585) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MDIVNLILVAVLIALTAFFVASEFAIIRIRGSRIDQLIAEGNKAAIAVKKVTTHLDEYLS ACQLGITLTSIGLGVLGESTIERLLHPLFVQMNVPGSLSHVISFIFAYAIITFLHVVVGE LAPKTVAIQKAEAVSMLFAKPLIWFYRIAFPFIWLLNNSARLLTKAFGLETVSENELAHS EEELRIILSESYKSGEINQSEFKYVNKIFEFDDRLAKEIMIPRTEIVSLPHDIKISEMMD IIQIEKYTRYPVEEGDKDNIIGVINIKEVLTACISGEVSVDSTISQFVNPIIHVIESAPI QDLLVKMQKERVHMAILSDEYGGTAGLVTVEDIIEEIVGEIRDEFDIDEISEIRKIGEGH YILDGKVLIDQVNDLLGIHLENEEVDTIGGWFLTQKYDVEKDDSIIEEGCEFIINEIDGH HVAYIEVKKLQEEELLETANQQEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yhdP |
Synonyms | yhdP; BSU09550; UPF0053 protein YhdP |
UniProt ID | O07585 |
◆ Recombinant Proteins | ||
GAN-1614H | Recombinant Human GAN protein, His & T7-tagged | +Inquiry |
FCGR1-1674R | Recombinant Rhesus monkey FCGR1 Protein, His-tagged | +Inquiry |
PDGFB-4838H | Recombinant Human PDGFB Protein (Glu21-Ala241), C-His tagged | +Inquiry |
PDZK1-30832TH | Recombinant Human PDZK1 | +Inquiry |
RFL8396DF | Recombinant Full Length Drosophila Melanogaster Probable G-Protein Coupled Receptor Mth-Like 8(Mthl8) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CHOD-22 | Active Native Cholesterol esterase | +Inquiry |
C3-8092H | Native Human Plasma COMPLEMENT C (C3) | +Inquiry |
XOD-22B | Native Bovine XOD Protein | +Inquiry |
IgG-017R | Native Rabbit IgG Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
GPDH-119R | Active Native Rabbit Glycerol-3-phosphate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
AR-8764HCL | Recombinant Human AR 293 Cell Lysate | +Inquiry |
VN1R1-401HCL | Recombinant Human VN1R1 293 Cell Lysate | +Inquiry |
CETN2-7561HCL | Recombinant Human CETN2 293 Cell Lysate | +Inquiry |
POLR2D-3035HCL | Recombinant Human POLR2D 293 Cell Lysate | +Inquiry |
ITGB1BP3-879HCL | Recombinant Human ITGB1BP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yhdP Products
Required fields are marked with *
My Review for All yhdP Products
Required fields are marked with *
0
Inquiry Basket