Recombinant Full Length Bacillus Subtilis Uncharacterized Protein Yqhq(Yqhq) Protein, His-Tagged
Cat.No. : | RFL14615BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized protein yqhQ(yqhQ) Protein (P54515) (1-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-318) |
Form : | Lyophilized powder |
AA Sequence : | MSKHKVPPAYGGQAVVEGVMFGGKHHYVTAIRRTDGSIDFFKLPRKHNPKLNIVKKIPFL RGIAAIIEASANGTKHLNFSSERYGLDPSEDETLEQEEKKSSGLSMYLSLAVIGVLSFLF SKFVFTLVPVFLAELTRPIFSLNTAQIAIESLFKLILLLGYIYFLSMTPLIKRVFQYHGA EHKVINCYEQNLPITVENVQNQSRLHYRCGSSFILFTIIVGMFVYLLVPTDPLWLRVIDR VALIPVVLGISFEVLQLTNKVRDIPGLKLLGYPGLWLQLLTTKEPKDEQVEVAIESFNEL LRLEALSEQNQKPSHNVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yqhQ |
Synonyms | yqhQ; BSU24490; Uncharacterized protein YqhQ |
UniProt ID | P54515 |
◆ Recombinant Proteins | ||
AZGP1-002H | Recombinant Human AZGP1 Protein, C-His tagged | +Inquiry |
CSRP1-674H | Recombinant Human CSRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Coq3-2269M | Recombinant Mouse Coq3 Protein, Myc/DDK-tagged | +Inquiry |
THBS2-101H | Active Recombinant Human THBS2, His-tagged | +Inquiry |
VCAN-5678H | Recombinant Human VCAN Protein (Leu21-Lys347), N-His tagged | +Inquiry |
◆ Native Proteins | ||
F13A1-28806TH | Native Human F13A1 | +Inquiry |
PLF4-88H | Active Native Human PF 4 | +Inquiry |
F12-28805TH | Native Human F12 | +Inquiry |
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
Annexin-V-011H | Native Human Annexin-V Protein, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH1L1-17HCL | Recombinant Human ALDH1L1 lysate | +Inquiry |
CSF3R-1803HCL | Recombinant Human CSF3R cell lysate | +Inquiry |
DIXDC1-6917HCL | Recombinant Human DIXDC1 293 Cell Lysate | +Inquiry |
ATF5-8629HCL | Recombinant Human ATF5 293 Cell Lysate | +Inquiry |
TNFRSF14-001MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yqhQ Products
Required fields are marked with *
My Review for All yqhQ Products
Required fields are marked with *
0
Inquiry Basket