Recombinant Full Length Bacillus Subtilis Uncharacterized Protein Yito(Yito) Protein, His-Tagged
Cat.No. : | RFL22883BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized protein yitO(yitO) Protein (O06750) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MLENIKQTITRWDERNPWTNVYGLARSIIALSSLLTLLINHPSLIMKPASGISSYPACKM NLSLFCLGENNYMMLNLFRWVCIAILVLVVIGWRPRITGVLHWYVSYSLQSSLIVIDGGE QAAAVMTFLLLPITLTDPRKWHWSTRPIEGKRTLGKITAFISYFVIRIQVAVLYFHSTVA KLSQQEWVDGTAVYYFAQEKTIGFNGFFQALTKPIVTSPFVVIPTWGTLLVQIVIFAALF APKKHWRLILIIAVFMHEIFAVMLGLISFSIIMAGILILYLTPIDSTIQFTYIRRLLWNK KHKKGEVSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yitO |
Synonyms | yitO; BSU11055; BSU11050/BSU11060; Uncharacterized protein YitO |
UniProt ID | O06750 |
◆ Recombinant Proteins | ||
HRAS-1284R | Recombinant Rat HRAS Protein (2-186 aa), His-tagged | +Inquiry |
Il11ra1-141M | Recombinant Mouse Il11ra1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCT2-382C | Recombinant Cynomolgus CCT2 Protein, His-tagged | +Inquiry |
PIH1D1-6731M | Recombinant Mouse PIH1D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tor1aip2-1573M | Recombinant Mouse Tor1aip2 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Acta1-158M | Native Mouse skeletal muscle alpha Actin | +Inquiry |
Collagen-49B | Native Bovine Collagen Type XI/XI | +Inquiry |
Annexin-V-011H | Native Human Annexin-V Protein, FITC conjugated | +Inquiry |
GG-193R | Native Rat Gamma Globulin protein | +Inquiry |
HPIV1ag-276V | Native Parainfluenza Virus type 1(strain Sendai) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCRL2-312HCL | Recombinant Human CCRL2 cell lysate | +Inquiry |
DYNLL1-6757HCL | Recombinant Human DYNLL1 293 Cell Lysate | +Inquiry |
ZC3H12A-745HCL | Recombinant Human ZC3H12A lysate | +Inquiry |
CTAG1A-204HCL | Recombinant Human CTAG1A lysate | +Inquiry |
MANF-1581MCL | Recombinant Mouse MANF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yitO Products
Required fields are marked with *
My Review for All yitO Products
Required fields are marked with *
0
Inquiry Basket