Recombinant Full Length Bacillus Subtilis Uncharacterized Membrane Protein Yvlc(Yvlc) Protein, His-Tagged
Cat.No. : | RFL6807BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized membrane protein yvlC(yvlC) Protein (O34719) (1-65aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-65) |
Form : | Lyophilized powder |
AA Sequence : | MNKLYRSEKNKKIAGVIGGLAEYFNWDASLLRVITVILAIMTSVLPVLLIYIIWIFIVPS ERDMK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yvlC |
Synonyms | yvlC; BSU35110; Uncharacterized membrane protein YvlC |
UniProt ID | O34719 |
◆ Recombinant Proteins | ||
SDHA-5290R | Recombinant Rat SDHA Protein | +Inquiry |
RASGEF1B-13949M | Recombinant Mouse RASGEF1B Protein | +Inquiry |
DECR2-27085TH | Recombinant Human DECR2, His-tagged | +Inquiry |
LSAMP-9323M | Recombinant Mouse LSAMP Protein | +Inquiry |
DDX25-4408M | Recombinant Mouse DDX25 Protein | +Inquiry |
◆ Native Proteins | ||
Placenta-020H | Human Placenta Lysate, Total Protein | +Inquiry |
BSI-B4-851 | Active Native Bandeiraea simplicifolia Isolectin B4 protein, biotin-conjugated | +Inquiry |
Lectin-1800L | Active Native Lycopersicon Esculentum Lectin Protein, Agarose bound | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
MBLG-167B | Native Bovine milk β-Lactoglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLFM4-2429HCL | Recombinant Human OLFM4 cell lysate | +Inquiry |
POGLUT1-4836HCL | Recombinant Human KTELC1 293 Cell Lysate | +Inquiry |
CTSB-1885MCL | Recombinant Mouse CTSB cell lysate | +Inquiry |
ACVRL1-3001RCL | Recombinant Rat ACVRL1 cell lysate | +Inquiry |
ZNF449-71HCL | Recombinant Human ZNF449 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yvlC Products
Required fields are marked with *
My Review for All yvlC Products
Required fields are marked with *
0
Inquiry Basket