Recombinant Full Length Bacillus Subtilis Uncharacterized Membrane Protein Yvbj(Yvbj) Protein, His-Tagged
Cat.No. : | RFL5311BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized membrane protein yvbJ(yvbJ) Protein (O32247) (1-605aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-605) |
Form : | Lyophilized powder |
AA Sequence : | MLFCKNCGSQNNEGAKFCKQCGTPIGGGSKQANQETASTAETRQAPRKPIPKKTIILWSS IAAACVILFAAYKTGAYFTSKDRLVDKFEQAVNDGDQDQIATLLTPVNDNLKLTKNNVKP FLTYLKDHPDKKDELFASLRDETAQKDIVYAEKDGKSLLVFDHYDLKVAPVYFEVSSNYK NTDLYVNKEEAGSVKKADQAQTLGPYIPGEYTVSAKLKNDVVDLVKKEDIQAIGDSSFRV DLSLEADDVTFSLANDIKSGKGDLLINGKSIHKDPFKSVTYGPLLTDGSMTASVEAEFPW GKTKTAGVPIDDKEMELTLIPDQDTQEQIMNTIVKTTKQYSKALSDGNTAQMTEASANWK AETKDTVDSMKSADSYLKDRYLETDFDLDTFALSQKNDGTWQVSVTGKELHQSSSYNDYT KSEMTDDSPSYEYLLSYDKKQKKWIFEDAESTFESAGTNIKKIKNDKPETYTSAWAGSKN KGSESSASGDVTDEQVTLFMGSYLQSQADAVNQNNFSLMEDSLEKGSSLYSDQQHLVSKL NKEGTTEDFNNYEVKSWSQNGSAITIKTYEEFYITKSGGSPKLRTYNWTYTGVVKNGRIY LTSIQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yvbJ |
Synonyms | yvbJ; BSU33880; Uncharacterized membrane protein YvbJ |
UniProt ID | O32247 |
◆ Recombinant Proteins | ||
MALT1-9472M | Recombinant Mouse MALT1 Protein | +Inquiry |
S-33S | Recombinant SARS-CoV-2 S Protein, Fc-tagged | +Inquiry |
PANK2-5102Z | Recombinant Zebrafish PANK2 | +Inquiry |
ACOT7-043H | Recombinant Human ACOT7 protein, GST-tagged | +Inquiry |
CRKL-26624TH | Recombinant Human CRKL, His-tagged | +Inquiry |
◆ Native Proteins | ||
TSH-108H | Active Native Human Thyroid Stimulating Hormone | +Inquiry |
TF-48P | Native Pig Transferrin (TRF) Protein | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
TNNT2-4655H | Native Human Troponin T Type 2 (Cardiac) | +Inquiry |
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
WNT16-300HCL | Recombinant Human WNT16 293 Cell Lysate | +Inquiry |
A549-043WCY | Human Lung Adenocarcinoma A549 Whole Cell Lysate | +Inquiry |
PLOD3-1379HCL | Recombinant Human PLOD3 cell lysate | +Inquiry |
HDDC2-5599HCL | Recombinant Human HDDC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yvbJ Products
Required fields are marked with *
My Review for All yvbJ Products
Required fields are marked with *
0
Inquiry Basket