Recombinant Full Length Bacillus Subtilis Uncharacterized Abc Transporter Permease Yvrn(Yvrn) Protein, His-Tagged
Cat.No. : | RFL16749BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized ABC transporter permease yvrN(yvrN) Protein (P46324) (1-409aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-409) |
Form : | Lyophilized powder |
AA Sequence : | MLEHIRISFQSIFSHKLRSILTMLGVIIGIAAIIAIVSMLKGQSEQLKQSMIGMGNNAIN VVYQPSGGEEESGGPQVSYASAPPVAEETVKAIKSDPMVKGLSLYYLSEGASVFHLTNVS YPQVYGVDDDYFDMFPIRITEGRKLTENDLNSTHQVVMINEAVRDELFPDGEALHKSIEM NGVPFKVVGVFKEKNQQESMFEGDYANPVLYVPKKVWPLIEGFDAPTQIAVQADSSEHIQ EAGVMAADLLNQGLSEAELEKAEYSVMDLQEIAQEVESFNQSFALLLGGIASISLLVGGI GVMNIMLVSVTERTREIGIKKALGAKRRVILFQFLTEAVVLTSIGGILGVLAGFGIAKLL TVIFPMPFIVSIPAVVGALIFSMAVGIIFGLLPSIKASKLQPVDALRYE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yvrN |
Synonyms | yvrN; yvrM; yziB; BSU33260; Uncharacterized ABC transporter permease YvrN |
UniProt ID | P46324 |
◆ Recombinant Proteins | ||
LRRC37B-5961HF | Recombinant Full Length Human LRRC37B Protein | +Inquiry |
Caln1-1019M | Recombinant Mouse Caln1 Protein, MYC/DDK-tagged | +Inquiry |
NLGN4Y-02H | Recombinant Human NLGN4Y Protein(Gln44-Leu675), His-tagged | +Inquiry |
IRF1-3169H | Recombinant Human IRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HDM427793H | Recombinant Human HDM4 (7-111) Protein | +Inquiry |
◆ Native Proteins | ||
Factor 4-88H | Native Human Platelet Factor 4 | +Inquiry |
CAT-5276H | Native Human, Catalase | +Inquiry |
SERPINA3-5331H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 3 | +Inquiry |
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
Arp 2/3 complex-856P | Native Porcine Arp 2/3 complex Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCDH10-1293HCL | Recombinant Human PCDH10 cell lysate | +Inquiry |
SCHIP1-2034HCL | Recombinant Human SCHIP1 293 Cell Lysate | +Inquiry |
OGDH-454HCL | Recombinant Human OGDH lysate | +Inquiry |
IGSF8-1378MCL | Recombinant Mouse IGSF8 cell lysate | +Inquiry |
SH3BP5L-1869HCL | Recombinant Human SH3BP5L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yvrN Products
Required fields are marked with *
My Review for All yvrN Products
Required fields are marked with *
0
Inquiry Basket