Recombinant Full Length Bacillus Subtilis Spore Germination Protein B1(Gerba) Protein, His-Tagged
Cat.No. : | RFL16357BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Spore germination protein B1(gerBA) Protein (P39569) (1-483aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-483) |
Form : | Lyophilized powder |
AA Sequence : | MQIDSDLQNNLDTLKKTLGQNDDMMFYTFAFGDSRQKACLLYIDGLTENKMLAQYVISPL QKEALAHKECSIEDLSAFFFGFHHSVVSTMKEIEQLVFSGQAILLADGYRGGLAFDTKSV ATRSLDEPSSEVVERGPKIGFIEKLRTNTALLRERTSDPNLVIKEMTLGKRTKKKIAVAY IQDIAPDYVVKEVFKRLKSVNIDNLPESGTLEQLIEDEPFSIFPTILSTERPDRVESSLL EGRVSILVDGTPFALIVPATVDEFIHSPDDYSQRWIPMSLVRLLRYSSILITIYLPGLYI SLVSFHTGLLPTRMAISIAGSRLNVPFPPFVEAFIMIFTIELIREAGLRLPKPIGQTIGL IGGVVIGQAAVQAQIVSALMVIVVSVTALASFTVPSYAYNFPLRIIRIGVMISATALGMY GVIMVYLFVIGHLMRLKSFGQDYIIPIMAQPGQDLKDTVIRIPTMFLKRRPTRNDPEDNI RQR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gerBA |
Synonyms | gerBA; BSU35800; Spore germination protein B1 |
UniProt ID | P39569 |
◆ Recombinant Proteins | ||
htpG-4505B | Recombinant Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) htpG protein, His-SUMO & Myc-tagged | +Inquiry |
AFMID-92H | Recombinant Human AFMID Protein, His&GST-tagged | +Inquiry |
CAGE1-2640M | Recombinant Mouse CAGE1 Protein | +Inquiry |
GPBAR1-1041HFL | Recombinant Human GPBAR1 protein, His&Flag-tagged | +Inquiry |
ALDH3A1-1405HF | Recombinant Full Length Human ALDH3A1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
PTI-29B | Active Native Bovine Aprotinin | +Inquiry |
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
NTF3-29249TH | Native Human NTF3 | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
MBLG-167B | Native Bovine milk β-Lactoglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17RA-2640HCL | Recombinant Human IL17RA cell lysate | +Inquiry |
F11R-2741HCL | Recombinant Human F11R cell lysate | +Inquiry |
PHLDA3-3219HCL | Recombinant Human PHLDA3 293 Cell Lysate | +Inquiry |
INSL4-001HCL | Recombinant Human INSL4 cell lysate | +Inquiry |
CD86-2619HCL | Recombinant Human CD86 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gerBA Products
Required fields are marked with *
My Review for All gerBA Products
Required fields are marked with *
0
Inquiry Basket