Recombinant Full Length Bacillus Subtilis Spore Germination Protein A1(Geraa) Protein, His-Tagged
Cat.No. : | RFL1191BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Spore germination protein A1(gerAA) Protein (P07868) (1-482aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-482) |
Form : | Lyophilized powder |
AA Sequence : | MEQTEFKEYIHDNLALVLPKLKENDDLVKNKKMLANGLVFYYLYFSEMTDENKVSEAIKT LIKDEETLTLDQVKKRLDQLDARPVETAKKTIESILNGNCAVFINGLDKAYILTTGKKKT RSLTEPTTEKVVRGPKVAFVEDIDTNLALIRQRTSHPKLITKKIMIGENKLKPAAIMYIE GKAKKSVIKEVKARLKNIQLEDIQDSGTLEELIEDNKYSPFPQIQNTERPDKVSSALFNG RVAILVDSSPFVLLVPVSLGILMQSPDDYYERWISASLIRSLRFASIFITLFLSSIYITL VSFHQGLLPTALAVTISANRENVPFPPIFEALLMEVTIELLREAGLRLPNPLGQTIGLVG GVVIGQAAVEANLVSSILVIVVSVIALASFTVPQYGMGLSFRVLRFISMFSAAILGLYGI ILFMLVVYTHLTRQTSFGSPYFSPNGFFSLKNTDDSIIRLPIKNKPKEVNNPNEPKTDST ET |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gerAA |
Synonyms | gerAA; gerA1; BSU33050; Spore germination protein A1 |
UniProt ID | P07868 |
◆ Native Proteins | ||
CKM-5306H | Native Human creatine kinase, muscle | +Inquiry |
Myh2-13R | Active Native Rabbit Myosin II Protein | +Inquiry |
ALB-5363B | Native Bovine Albumin | +Inquiry |
SERPINA7-8269H | Native Human Serum Thyroxine Binding Globulin | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC30A8-1737HCL | Recombinant Human SLC30A8 293 Cell Lysate | +Inquiry |
METRN-1279MCL | Recombinant Mouse METRN cell lysate | +Inquiry |
C17orf81-8227HCL | Recombinant Human C17orf81 293 Cell Lysate | +Inquiry |
GALNTL6-6030HCL | Recombinant Human GALNTL6 293 Cell Lysate | +Inquiry |
TBX21-1747HCL | Recombinant Human TBX21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All gerAA Products
Required fields are marked with *
My Review for All gerAA Products
Required fields are marked with *
0
Inquiry Basket