Recombinant Full Length Bacillus Subtilis Spbc2 Prophage-Derived Uncharacterized Protein Yope(Yope) Protein, His-Tagged
Cat.No. : | RFL26234BF |
Product Overview : | Recombinant Full Length Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopE(yopE) Protein (O31933) (1-83aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-83) |
Form : | Lyophilized powder |
AA Sequence : | MIGLAYFLIIWLGVGLLTGIKFIFVDQVYDEEFKELMDKETAAGMERNLASLFFKNKLNV IAFFMLIGLLPLAMRITKLFKRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yopE |
Synonyms | yopE; BSU20920; SPbeta prophage-derived uncharacterized protein YopE |
UniProt ID | O31933 |
◆ Recombinant Proteins | ||
Il17f-1665M | Recombinant Mouse Il17f Protein, His-tagged | +Inquiry |
NXPH2-3708H | Recombinant Human NXPH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HMGCLL1-13846H | Recombinant Human HMGCLL1, His-tagged | +Inquiry |
STX4A-8840M | Recombinant Mouse STX4A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL6634BF | Recombinant Full Length Bovine P2Y Purinoceptor 14(P2Ry14) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LCN2-384H | Native Human LCN2 | +Inquiry |
HBsAg-01 | Native Hepatitis B Surface Ag protein | +Inquiry |
293T-01NE | Native HEK293 Nuclear Extract | +Inquiry |
Elastase-26P | Native Pseudomonas Aeruginosa Elastase | +Inquiry |
ALOD-36 | Active Native Alcohol oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEDD-6996HCL | Recombinant Human DEDD 293 Cell Lysate | +Inquiry |
FAM46B-6375HCL | Recombinant Human FAM46B 293 Cell Lysate | +Inquiry |
MUS81-4056HCL | Recombinant Human MUS81 293 Cell Lysate | +Inquiry |
KPNA6-4887HCL | Recombinant Human KPNA6 293 Cell Lysate | +Inquiry |
DDR1-2534HCL | Recombinant Human DDR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yopE Products
Required fields are marked with *
My Review for All yopE Products
Required fields are marked with *
0
Inquiry Basket