Recombinant Full Length Bacillus Subtilis Spbc2 Prophage-Derived Uncharacterized Protein Yopa(Yopa) Protein, His-Tagged
Cat.No. : | RFL25631BF |
Product Overview : | Recombinant Full Length Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopA(yopA) Protein (O31937) (1-438aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-438) |
Form : | Lyophilized powder |
AA Sequence : | MENIALESSFLEYDINEPIKIYTGHFTIEVADDFFEILGEVKIAFLPKARLIFEGAISGN LSKLFEFEKAMKSNNMMINVPGFMKSEVLISGITDGSKGNKVSGILKRSILTSAETKVNR MEFTVVNFVNDLGRRIVHGRFKFSGRTKLKYKDWEIILDKRYDYSNKKIFDRLKNSGGYL ITHVGYLKRVDDKLFDTKEVEPLISGLYWLLSFSAGRHVAIPTLEGYHNEEVIWSKYQVP LIDGWTNNITWFPKQKSPSLEHLFPKVIEKQEDPFWNKVLWEVLSWYSQAHSSSIVENKV VSVQVALETLAWVYLIVDRKSNISKSKYKYMNAAEKFREILSRFSIDLSIPKLFIDIKDN YDDGPHLFTVFRNKIVHPTRELDFDNPIDKLHVLYLGVWYLELLTLGILGYEGSYVNRLK VPIIEGVYEFVPWKTRDN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yopA |
Synonyms | yopA; BSU20960; SPbeta prophage-derived uncharacterized protein YopA |
UniProt ID | O31937 |
◆ Recombinant Proteins | ||
SAP060A-016-4130S | Recombinant Staphylococcus aureus (strain: 502A, other: MSSA) SAP060A_016 protein, His-tagged | +Inquiry |
YUFS-3244B | Recombinant Bacillus subtilis YUFS protein, His-tagged | +Inquiry |
Ensa-3364M | Recombinant Mouse Ensa, His-tagged | +Inquiry |
DKC1-1272R | Recombinant Rhesus monkey DKC1 Protein, His-tagged | +Inquiry |
Crh-7792M | Recombinant Mouse Crh protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Streptavidin-24 | Streptavidin | +Inquiry |
KLH-82 | Native Hemocyanin-Keyhole Limpet (KLH) subunits | +Inquiry |
SPARC-30653TH | Native Human SPARC | +Inquiry |
TF-002H | Native Human TF Protein, Rhodamine Conjugated | +Inquiry |
sPLA2-60B | Native Bee Venom sPLA2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVRL1-994CCL | Recombinant Canine ACVRL1 cell lysate | +Inquiry |
DTNA-6800HCL | Recombinant Human DTNA 293 Cell Lysate | +Inquiry |
ZNF524-59HCL | Recombinant Human ZNF524 293 Cell Lysate | +Inquiry |
ATP6V1H-8573HCL | Recombinant Human ATP6V1H 293 Cell Lysate | +Inquiry |
GABBR1-6073HCL | Recombinant Human GABBR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yopA Products
Required fields are marked with *
My Review for All yopA Products
Required fields are marked with *
0
Inquiry Basket