Recombinant Full Length Bacillus Subtilis Spbc2 Prophage-Derived Sublancin-168-Processing And Transport Atp-Binding Protein Sunt(Sunt) Protein, His-Tagged
Cat.No. : | RFL3764BF |
Product Overview : | Recombinant Full Length Bacillus subtilis SPBc2 prophage-derived sublancin-168-processing and transport ATP-binding protein SunT(sunT) Protein (P68579) (1-705aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-705) |
Form : | Lyophilized powder |
AA Sequence : | MNKKKKYVHTKQFNSHDCGLACISSILKFHNLNYGIDFLLDLIGDKEGYSLRDLIVIFKK MGIKTRPLELQENKTFEALKQIKLPCIALLEGEEYGHYITIYEIRNNYLLVSDPDKDKIT KIKKEDFESKFTNFILEIDKESIPEKEKDQKKHSYFFKDILFRNKLIVFVILLTSLFVVG LAVAGSFYIKFLVDLIIPRSLRESLITITLIFISMVLIRCIFDFVRSYLIIKLSYKVDKE MSNVYFNKVTKLPINFFENREDGEVISRFNDGIYIKDFFSANFVTAIIDIILILGLGVIL YRTNNILFLTIILPILLLSCLAILFFDHLKKKNQKLMEDKAKSTSLLINFLKNMTTVYSL NKTSFFLEKFHLTYDKQLNSTFSVAKAVISNEILKGLIQNSFTIIILWVGTRQVLNDSMS LGTLLFINTLAAFLLSSLDRILSMQSDLQQAHVASIRFFDVVNYPVQQDSNENLTELDFI QNIKTVNLNIGADPMRYIVEDINLILDRKDKVLIIGESGTGKSTFAKSLSKLYKVPDKSI YLNGLDINRYDHLSIRKRIVYIDENPFLFKGTIKENLCMGEIFDQNEIENACIMSQCHEF ICNLDKQYSYKLSENGSNLSTGQKQRLALARAILHQPQVLILDESLSNIDPDNTKLIYET LHRMDCLIILITHNDPSNFKYNKKLVFRNNRIIESSYSENKEYSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sunT |
Synonyms | sunT; yolH; BSU21470; SPbeta prophage-derived sublancin-168-processing and transport ATP-binding protein SunT |
UniProt ID | P68579 |
◆ Recombinant Proteins | ||
USP5-681H | Recombinant Human USP5 Protein, MYC/DDK-tagged | +Inquiry |
FGF23-3431H | Recombinant Human FGF23 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AGR3-577H | Recombinant Human AGR3 Protein, Fc-tagged | +Inquiry |
ASGR2-7375H | Recombinant Human ASGR2 protein, His-tagged | +Inquiry |
Ube2j1-6790M | Recombinant Mouse Ube2j1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
FGB-46P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
VTN-31737TH | Native Human VTN | +Inquiry |
CRP-5299H | Native Human C-Reactive Protein, Pentraxin-Related | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53TG3-855HCL | Recombinant Human TP53TG3 293 Cell Lysate | +Inquiry |
BoneMarrow-506D | Dog Bone Marrow Lysate, Total Protein | +Inquiry |
PFKFB3-471HCL | Recombinant Human PFKFB3 cell lysate | +Inquiry |
TRIM24-789HCL | Recombinant Human TRIM24 293 Cell Lysate | +Inquiry |
PWP1-2656HCL | Recombinant Human PWP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sunT Products
Required fields are marked with *
My Review for All sunT Products
Required fields are marked with *
0
Inquiry Basket