Recombinant Full Length Bacillus Subtilis Putative Transport Permease Yfim(Yfim) Protein, His-Tagged
Cat.No. : | RFL20340BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Putative transport permease yfiM(yfiM) Protein (P94441) (1-396aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-396) |
Form : | Lyophilized powder |
AA Sequence : | MKKSIWIAWKDVKIRITDRKGFMMLILMPLILTCILGAALGSVVDGGSRIDDIKVGYIQS DQSDTANMFTKDVLKKMKSIKVTKVGSKDKMKKLIDEKKIDVGIVIPNHWEAGKTSAVVN AAPDQTLKSSIIETAASSFIEQYKAVKEAASGSMDYISKTEAVKQGKLDPAQFAEKLAKT LEKETGDKLTIAEKSVGSKAVTSFQYYSAAMLCMFMLFHITVGAKSFLQEKDTETLARML MTPAQKSVILFGKWLGTYLFAIIQFFIFLIVTINVFGVDWGGNLLLVSVLGLSYAAAVSG ISMLLASCISDMKTADAIGGFGIQLLAVLGGSMLPLYQFPDVLQSVSKAVPNRWALDGFL SLMEGGGWADLQKPVLLFAAIGFCSLVIGIRRLHTR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yfiM |
Synonyms | lnrM; bifM; yfiM; BSU08320; Linearmycin resistance permease protein LnrM |
UniProt ID | P94441 |
◆ Native Proteins | ||
ABL1-618H | Native Human C-abl Oncogene 1, Receptor Tyrosine Kinase | +Inquiry |
CGB-359H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
GG-193R | Native Rat Gamma Globulin protein | +Inquiry |
Immunoglobulin M-85H | Native Human Immunoglobulin M | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC22A24-1100HCL | Recombinant Human SLC22A24 cell lysate | +Inquiry |
CD58-1127HCL | Recombinant Human CD58 cell lysate | +Inquiry |
MED27-4385HCL | Recombinant Human MED27 293 Cell Lysate | +Inquiry |
Prostate-50H | Human Prostate Tissue Lysate | +Inquiry |
Brain-44H | Hamster Brain Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yfiM Products
Required fields are marked with *
My Review for All yfiM Products
Required fields are marked with *
0
Inquiry Basket