Recombinant Full Length Bacillus Subtilis Putative Membrane Protease Yugp(Yugp) Protein, His-Tagged
Cat.No. : | RFL209BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Putative membrane protease yugP(yugP) Protein (O05248) (1-225aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-225) |
Form : | Lyophilized powder |
AA Sequence : | MLFIFLTIAALGLSFWAQFKVKSNFEKYSKVEASSGRTGAETARRILDINGLYDVPVEPV RGTLTDHYDPTRRVVRLSEPVYYGRSISAISVASHEVGHALQHQESYGALVLRHKIFPVV NFASGVAPLLFLGGMLLGSLNLIGLGIILFSAAVFFQLITLPVEFNASSRAKQIIVSEGF IRNNEENGVNKVLSAAALTYVAAALVSLFELLRFVMIFLNGRDEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yugP |
Synonyms | yugP; BSU31310; Putative membrane protease YugP |
UniProt ID | O05248 |
◆ Recombinant Proteins | ||
RYR2-358H | Recombinant Human RYR2 | +Inquiry |
Cd74-6872R | Recombinant Rat Cd74 protein, His & GST-tagged | +Inquiry |
Bend3-1857M | Recombinant Mouse Bend3 Protein, Myc/DDK-tagged | +Inquiry |
CHRNA3-2697H | Recombinant Human CHRNA3 protein, His-SUMO & Myc-tagged | +Inquiry |
RFL15873CF | Recombinant Full Length Carassius Auratus Rhodopsin(Rho) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
MMP9-29698TH | Native Human MMP9 | +Inquiry |
HSV-1ag-265V | Active Native HSV-1 Protein | +Inquiry |
PLF4-88H | Active Native Human PF 4 | +Inquiry |
GLDH-120B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
Lecithin-10S | Native Soy Lecithin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR6A1-3704HCL | Recombinant Human NR6A1 293 Cell Lysate | +Inquiry |
ACTR1A-9053HCL | Recombinant Human ACTR1A 293 Cell Lysate | +Inquiry |
Rectum-410H | Human Rectum Liver Cirrhosis Lysate | +Inquiry |
CERS2-4819HCL | Recombinant Human LASS2 293 Cell Lysate | +Inquiry |
ITPRIPL1-5110HCL | Recombinant Human ITPRIPL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yugP Products
Required fields are marked with *
My Review for All yugP Products
Required fields are marked with *
0
Inquiry Basket