Recombinant Full Length Bacillus Subtilis Putative Glycosyltransferase Csbb(Csbb) Protein, His-Tagged
Cat.No. : | RFL7733BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Putative glycosyltransferase CsbB(csbB) Protein (Q45539) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAAT CSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVI AQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSK GLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILL LSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPH YLIKEANIPNKDLPETNELKSMRRLTKMH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | csbB |
Synonyms | csbB; yfhN; BSU08600; Putative glycosyltransferase CsbB |
UniProt ID | Q45539 |
◆ Recombinant Proteins | ||
ETHE1-3522H | Recombinant Human ETHE1 Protein, GST-tagged | +Inquiry |
GADD45G-4660H | Recombinant Human GADD45G Protein, GST-tagged | +Inquiry |
RFL1442BF | Recombinant Full Length Bradyrhizobium Sp. Cbb3-Type Cytochrome C Oxidase Subunit Fixp(Fixp) Protein, His-Tagged | +Inquiry |
GDPD2-4838H | Recombinant Human GDPD2 Protein, GST-tagged | +Inquiry |
Git2-3216M | Recombinant Mouse Git2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CAT-75H | Native Human Catalase | +Inquiry |
RNASE1-392C | Native Cattle RNASE1 Protein | +Inquiry |
Collagen type I & III-185 | Native Porcine Collagen type I & III Protein | +Inquiry |
Uricase-089P | Active Native Porcine Uricase Protein | +Inquiry |
LDH2-20H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BIN1-8454HCL | Recombinant Human BIN1 293 Cell Lysate | +Inquiry |
DYNC1I1-238HCL | Recombinant Human DYNC1I1 lysate | +Inquiry |
TJAP1-1056HCL | Recombinant Human TJAP1 293 Cell Lysate | +Inquiry |
MIB1-4324HCL | Recombinant Human MIB1 293 Cell Lysate | +Inquiry |
Appendix-19H | Human Appendix Lupus Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All csbB Products
Required fields are marked with *
My Review for All csbB Products
Required fields are marked with *
0
Inquiry Basket