Recombinant Full Length Bacillus Subtilis Protein Natb(Natb) Protein, His-Tagged
Cat.No. : | RFL32199BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Protein natB(natB) Protein (P46904) (1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-386) |
Form : | Lyophilized powder |
AA Sequence : | MLSHIYKKEMIDALRDRKTILLTILVPMIMMLGLVFFYESMLSDKGEQYTLAVGHSLPPA LESKLNEIDEISVKTFAKPEEAVDEGKADAYLNVPKEFDSYVNSMTPFKVDVYGNSIDQG SSNAMQLVQSALDQYKNEIVQQRLTNKHIDQSVIQPFTIQQKEADEEKGTSAIMLSAILP MLILTSIVSGAMPIALDIMAGEKDRKSIEALLLTPVSRNKVLVGKWLAVSTFGVASGVFA LVFLILSTVLFTENLKTAFQLGDHMWSVIGASALIIVLSALLISAMELFISIMSSSVKEA QSYMSLVVFLPVFPMFFIFSKAPNQFDLSYFLIPFLNLHALFKQLLFGMVDPATILSTSG TIAVLIAIFFLLARACFLKDKWVLPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | natB |
Synonyms | natB; BSU02760; ABC transporter permease protein NatB; ABC-type Na(+ transporter |
UniProt ID | P46904 |
◆ Recombinant Proteins | ||
C10orf54-539H | Recombinant Human C10orf54 Protein, Fc-tagged | +Inquiry |
DUSP3-2939H | Recombinant Human DUSP3 Protein, GST-tagged | +Inquiry |
cry1Ac-4123B | Recombinant Bacillus thuringiensis subsp. Kurstaki cry1Ac protein, GST-tagged | +Inquiry |
ADIPOQ-47H | Active Recombinant Human ADIPOQ, Trimeric Form | +Inquiry |
RCAN1A-1042Z | Recombinant Zebrafish RCAN1A | +Inquiry |
◆ Native Proteins | ||
DENV2-01DCL | Native DENV2 Lysate | +Inquiry |
LIPO-02E | Native Escherichia coli Lipopolysaccharides | +Inquiry |
Total RNA-01E | Native E. coli Total RNA | +Inquiry |
IgG-218D | Native Dog Immunoglobulin G | +Inquiry |
B. pertussis-36 | Native B. pertussis Filamentous Hemagglutinin Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAMP1-439HCL | Recombinant Human VAMP1 293 Cell Lysate | +Inquiry |
CD248-315HCL | Recombinant Human CD248 cell lysate | +Inquiry |
Bladder-737R | Rabbit Bladder Lysate, Total Protein | +Inquiry |
CTBS-7214HCL | Recombinant Human CTBS 293 Cell Lysate | +Inquiry |
C1orf144-8181HCL | Recombinant Human C1orf144 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All natB Products
Required fields are marked with *
My Review for All natB Products
Required fields are marked with *
0
Inquiry Basket