Recombinant Full Length Bacillus Subtilis Probable Anti-Sigma-M Factor Yhdk(Yhdk) Protein, His-Tagged
Cat.No. : | RFL14121BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Probable anti-sigma-M factor yhdK(yhdK) Protein (O07580) (1-96aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-96) |
Form : | Lyophilized powder |
AA Sequence : | MELVRIFKEHNVFGWISVGTAVLSLLLLNLAIISNVTFYSYQMLPFAMAAVPFGVVELFI KRGRTGPGLLGVILNLFVIICVYTIVSVDTNLQFGF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yhdK |
Synonyms | yhdK; BSU09500; Probable anti-sigma-M factor YhdK |
UniProt ID | O07580 |
◆ Recombinant Proteins | ||
OLR1-8842C | Recombinant Cynomolgus OLR1, His tagged | +Inquiry |
RFL33942OF | Recombinant Full Length Oryza Sativa Subsp. Japonica Formin-Like Protein 15(Fh15) Protein, His-Tagged | +Inquiry |
MED16-6211HF | Recombinant Full Length Human MED16 Protein, GST-tagged | +Inquiry |
CCR3-378C | Recombinant Cynomolgus CCR3 Protein, His-tagged | +Inquiry |
TWIST1-2622H | Recombinant Human TWIST1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SNCA-27339TH | Native Human SNCA | +Inquiry |
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FSCB-205HCL | Recombinant Human FSCB cell lysate | +Inquiry |
Y-79-1942H | Y-79 (human retinoblastoma) nuclear extract lysate | +Inquiry |
Small Intestine-447H | Human Small Intestine Cytoplasmic Lysate | +Inquiry |
ENTPD5-451HCL | Recombinant Human ENTPD5 cell lysate | +Inquiry |
OTUB1-3516HCL | Recombinant Human OTUB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yhdK Products
Required fields are marked with *
My Review for All yhdK Products
Required fields are marked with *
0
Inquiry Basket