Recombinant Full Length Bacillus Subtilis Lipoteichoic Acid Synthase-Like Yvgj(Yvgj) Protein, His-Tagged
Cat.No. : | RFL2298BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Lipoteichoic acid synthase-like yvgJ(yvgJ) Protein (O32206) (214-617aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (214-617) |
Form : | Lyophilized powder |
AA Sequence : | DEDSITAIKNYTEADYSKPDQSKFGLAKGRNVIFVTLESTQSFVLNEKVNGKEITPFMND LIKKSYSFDHFYQQTEQGKTSDSEFIVANSLYPSLSGAVFFTKSDHQFHTMYKSLKQHDY YSAVFHANHKTFWNRDVMYDTFGIDRFFDVDDFHVTPGTSTSWGLKDKEFLEQSAKKLKS LPQPFYSSFITLTNHFPFEIDEKDQLIDEFDSSSDLLNRYVTTVRYEDEALKHFIKKLKD EGLYENSMIVFMGDHYGISEAHNEAMAEFLGKDEITPYDNVQLQRVPFIIHIPGITDQQP ETIPDAGGQVDVRPTLMHLLGVETKGDIQFGNDLLSGDRTPFAVLRNGSFITNDYVYTKN TCYSQKTGEVLEDQDACLPYKEKANEELSLSDKILNGDLLRFSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yvgJ |
Synonyms | yvgJ; BSU33360; Lipoteichoic acid synthase-like YvgJ |
UniProt ID | O32206 |
◆ Recombinant Proteins | ||
PRPS2-4724R | Recombinant Rat PRPS2 Protein | +Inquiry |
HAPLN2-4575H | Recombinant Human HAPLN2 Protein, GST-tagged | +Inquiry |
ANKRD5-556M | Recombinant Mouse ANKRD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENTPD3-3370M | Recombinant Mouse ENTPD3 protein(Gln44-Pro485), His-tagged | +Inquiry |
RFL18555BF | Recombinant Full Length Bovine Lipase Maturation Factor 1(Lmf1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
FN1-2708H | Native Human FN1 protein | +Inquiry |
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
PSMA3-419S | Active Native S. aureus PSM-alpha 3 protein | +Inquiry |
EDN3-8304H | Native Human EDN3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG3-8625HCL | Recombinant Human ATG3 293 Cell Lysate | +Inquiry |
MAD2L1BP-4569HCL | Recombinant Human MAD2L1BP 293 Cell Lysate | +Inquiry |
PPA2-2994HCL | Recombinant Human PPA2 293 Cell Lysate | +Inquiry |
LUZP4-4603HCL | Recombinant Human LUZP4 293 Cell Lysate | +Inquiry |
CACYBP-7899HCL | Recombinant Human CACYBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yvgJ Products
Required fields are marked with *
My Review for All yvgJ Products
Required fields are marked with *
0
Inquiry Basket