Recombinant Full Length Bacillus Subtilis L-Arabinose Transport System Permease Protein Arap(Arap) Protein, His-Tagged
Cat.No. : | RFL2366BF |
Product Overview : | Recombinant Full Length Bacillus subtilis L-arabinose transport system permease protein AraP(araP) Protein (P94529) (1-313aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-313) |
Form : | Lyophilized powder |
AA Sequence : | MKPVKTGTVHPVPSAAKQSGWRDLFYSKKAAPYLFTAPFVLSFLVFFLYPIISVFIMSFQ RILPGEVSFVGLSNYTALNNPTFYTALWNTLEYTFWTLIVLIPVPLLLAIFLNSKLVKFR NIFKSALFIPALTSTIVAGIIFRLIFGEMETSLANSILLKLGFSPQNWMNNEHTGMFLMV LLASWRWMGINILYFLAGLQNVPKELYEAADIDGANTMKKFLHITLPFLKPVTVYVLTIS IIGGFRMFEESYVLWQNNSPGNIGLTLVGYLYQQGLAYNEMGYGAAIGIVLLIVILVVSL ISLKLSGSFKGEG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | araP |
Synonyms | araP; yseD; BSU28740; Arabinooligosaccharides transport system permease protein AraP |
UniProt ID | P94529 |
◆ Recombinant Proteins | ||
RFL18961BF | Recombinant Full Length Borrelia Burgdorferi Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
GOLGA2-29029TH | Recombinant Human GOLGA2, His-tagged | +Inquiry |
BTF3-5172H | Recombinant Human BTF3 protein, GST-tagged | +Inquiry |
SH-RS05945-5425S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS05945 protein, His-tagged | +Inquiry |
ARFGAP1-750H | Recombinant Human ARFGAP1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CFP-106H | Active Native Human Complement Factor P (Properdin) | +Inquiry |
KLK3-385H | Native Human Prostate Specific Antigen (PSA), High pI Isoform (IEF) | +Inquiry |
HP-192F | Native Feline Haptoglobin | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
S100A7-3195H | Native Human S100A7 protein(Met1-Gln101) | +Inquiry |
◆ Cell & Tissue Lysates | ||
NARFL-3968HCL | Recombinant Human NARFL 293 Cell Lysate | +Inquiry |
SYNDIG1-925HCL | Recombinant Human TMEM90B 293 Cell Lysate | +Inquiry |
TFPI2-2771HCL | Recombinant Human TFPI2 cell lysate | +Inquiry |
USP3-462HCL | Recombinant Human USP3 293 Cell Lysate | +Inquiry |
GAGE1-6051HCL | Recombinant Human GAGE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All araP Products
Required fields are marked with *
My Review for All araP Products
Required fields are marked with *
0
Inquiry Basket