Recombinant Full Length Bacillus Subtilis Ftsk Domain-Containing Protein Ydcq(Ydcq) Protein, His-Tagged
Cat.No. : | RFL7044BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Ftsk domain-containing protein YdcQ(ydcQ) Protein (P96634) (1-480aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-480) |
Form : | Lyophilized powder |
AA Sequence : | MSDFLNKRFWKYRGKRIRPYMRNNVKLAGAIIFVPVFLLSMFLFWREQLIHFDLSQVIKN FEWNVPLIIKSVLCSVLIAVGSIVASYFLLFDSYKKILHRQKIAKMIFSNKFYEKENVKV RKIFSNETDSKEKITYFPRMYYQVKNNHIYIRIAMDMSRFQNRFLDLGKDLENGLFCDLV DKQMEEGFVCFKLLYDVKKNRISIDDAVAENGVLPLMKHISWQFDKLPHMLIAGGTGGGK TYFMLTIIKACVGLGADVRILDPKNADLADLEEVLPKKVYSQKNGILMCLRKSVDGMMER MDEMKQMSNYKTGENYAYLGLKPVFIFFDEYVAFMDLLDMKERNEALSYMKQLVMLGRQA GYFLVLGAQRPDAKYLADGIRDQFSFRVSLGLMSDTGYGMMFGDVEKAYVNKKETGRGYA NVGTGSVLEFYSPIVPKGYDFMSSIKNALVGVEGAQATAVASGSVSDQTASGEGVSEANG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ydcQ |
Synonyms | ydcQ; BSU04860; Ftsk domain-containing protein YdcQ |
UniProt ID | P96634 |
◆ Recombinant Proteins | ||
TNFRSF18-1995H | Recombinant Human TNFRSF18 Protein, MYC/DDK-tagged | +Inquiry |
CHRDL1-5745C | Recombinant Chicken CHRDL1 | +Inquiry |
HSPA1A-4850H | Recombinant Human heat shock 70kDa protein 1A, GST-tagged | +Inquiry |
SAP107B-005-3951S | Recombinant Staphylococcus epidermidis (strain: SK30) SAP107B_005 protein, His-tagged | +Inquiry |
UBE2T-2297H | Recombinant Human UBE2T Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
OMD-137C | Native Chicken Ovomucoid | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
CAT-26409TH | Native Human CAT | +Inquiry |
◆ Cell & Tissue Lysates | ||
JAM3-1074HCL | Recombinant Human JAM3 cell lysate | +Inquiry |
RPL6-2191HCL | Recombinant Human RPL6 293 Cell Lysate | +Inquiry |
NTRK2-2683HCL | Recombinant Human NTRK2 cell lysate | +Inquiry |
LGALS9C-4760HCL | Recombinant Human LGALS9C 293 Cell Lysate | +Inquiry |
SW480-23HL | Human SW480 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ydcQ Products
Required fields are marked with *
My Review for All ydcQ Products
Required fields are marked with *
0
Inquiry Basket