Recombinant Full Length Bacillus Subtilis Flagellar Biosynthesis Protein Flha(Flha) Protein, His-Tagged
Cat.No. : | RFL29918BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Flagellar biosynthesis protein flhA(flhA) Protein (P35620) (1-677aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-677) |
Form : | Lyophilized powder |
AA Sequence : | MSTRDLSVLISVVLIVAMLVIPFPPWLLSILIIINISLALIVLLTTMNMQEALQFSIFPS LLLLLTLFRLGLNVSTTRSILSHGEGGKVVETFGNFVVGGNVLVGLVVFIILIIIQFIVI TKGAERVSEVAARFTLDAMPGKQMSIDADLNAGMITEQEAKHRREKVAREADFYGAMDGA SKFVKGDAIAGIIIVMINIIFGIVIGMLQQGMSIQEAASHFTMLTVGDGIVSQIPALLIS TATGIVVTRAASEGNLGHDITGQLFAYPKLLYVAAATIMLLGIFTPIGILLTGPLAGLLA FGAYTLSKSGKEKEEVDEILEEEAEVDELKSPESVVQLLHIDPIEFEFGYGLIPLADANQ GGDLLDRIVMIRRQLALELGLVIPVVRIRDNIALQPNEYRLKIKGNEVAKGELLLDHYLA MSPTPEDDLIEGIETVEPSFGLPAKWISEAVKDEADMLGYTVVDPASVVSTHITEKIKQH AHELIGRQETKQLIDHLKESYPVLVEEVTPNPLSVGDIQKVLAKLLKEKVSIRNLVTIFE TLADYGKLTTDSDLLTEYTRQALAKQITAQFAKENEVLKVVTCSGRVEKAIADGVQQTEH GNYLSLEPDISESIVRSVAKEAEQLSLRQETAILLCSPPVRMYVKQLLERYFPDLPVLSY NELEANVEVQSIGVVDI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | flhA |
Synonyms | flhA; BSU16390; Flagellar biosynthesis protein FlhA |
UniProt ID | P35620 |
◆ Recombinant Proteins | ||
ACTC1-283M | Recombinant Mouse ACTC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33011WF | Recombinant Full Length Magnesium Transport Protein Cora(Cora) Protein, His-Tagged | +Inquiry |
CTNNBIP1-5635C | Recombinant Chicken CTNNBIP1 | +Inquiry |
RFL32245SF | Recombinant Full Length Saccharomyces Cerevisiae Nadh-Cytochrome B5 Reductase 2(Mcr1) Protein, His-Tagged | +Inquiry |
SERPINF1-5907H | Recombinant Human SERPINF1 Protein (Gln20-Pro418), C-His tagged | +Inquiry |
◆ Native Proteins | ||
Lysostaphin-91S | Active Native Staphylococcus staphylolyticus Lysostaphin | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
Lectin-1868W | Active Native Wisteria Floribunda Lectin Protein, Agarose bound | +Inquiry |
S100BB-10H | Native Human S100BB | +Inquiry |
◆ Cell & Tissue Lysates | ||
RRP12-907HCL | Recombinant Human RRP12 cell lysate | +Inquiry |
MPND-633HCL | Recombinant Human MPND cell lysate | +Inquiry |
KCNIP4-5052HCL | Recombinant Human KCNIP4 293 Cell Lysate | +Inquiry |
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
CD27-1156CCL | Recombinant Cynomolgus CD27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All flhA Products
Required fields are marked with *
My Review for All flhA Products
Required fields are marked with *
0
Inquiry Basket