Recombinant Full Length Bacillus Subtilis Ferrous Iron Permease Efeu(Efeu) Protein, His-Tagged
Cat.No. : | RFL12963BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Ferrous iron permease EfeU(efeU) Protein (P39595) (23-481aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-481) |
Form : | Lyophilized powder |
AA Sequence : | EDDPIAALIQLNKQMIKSVKDGDMDSAQQTFDTFKAKWKKEEPSIKKENLSSHSEMDANI AMISLSFINQDARKLKTQLEELASHLETYQQAVVLKKTSSGQSRASLTAYIQSLKDTKQF IEKKQLDEASSAIDNLVTSWLAVEGDVVSQSKEAYTTSEENLALMKAEIGSHPEKVSKQI DEMIQLLEPIASSSYSWWDAALIPVREGMEALLVIGALLTMTKKARVTRSSTWIWGGASA GMAVSLAAGIGVTVLFSSSVFGENNFLLGGVTGVLSAVMLLYVGVWLHRNASMDKWREKI NIQKSQALKKRSLLSFALIAFLAVVREGLETVIFFIGLVGKLPLTELIGGTAAGLIVLVI VGVLMIKLGMRIPLKPFFLLSMAVVLYMCVKFLGTGVHSLQLAGILPSDAESWLPSVSVL GIYPSVYSTIPQMLILLFLLIALVSEAAKHFTNGKELTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | efeU |
Synonyms | efeU; ywbL; BSU38280; ipa-27d; Ferrous iron permease EfeU; Fe(2+ ion permease EfeU; Ferrous iron uptake protein |
UniProt ID | P39595 |
◆ Recombinant Proteins | ||
FGF2-82H | Active Recombinant Human FGF2 Protein | +Inquiry |
SF3B5-3988R | Recombinant Rhesus Macaque SF3B5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPSF-3020S | Recombinant Staphylococcus epidermidis ATCC 12228 RPSF protein, His-tagged | +Inquiry |
TFRC-333H | Recombinant Human TFRC Protein, Flag-tagged | +Inquiry |
RFL25031CF | Recombinant Full Length Metaxin-1 Homolog(Mtx-1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ALOD-36 | Active Native Alcohol oxidase | +Inquiry |
MB-237C | Native Dog Myoglobin | +Inquiry |
LDL-402H | Native Human Low Density Lipoprotein, High Oxidized, DiI labeled | +Inquiry |
PT-141B | Native Bordetella pertussis Perrtussis toxin | +Inquiry |
FGB-46P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP7-516HCL | Recombinant Human DUSP7 cell lysate | +Inquiry |
PDXDC2P-1006HCL | Recombinant Human PDXDC2P cell lysate | +Inquiry |
GABPB2-1095HCL | Recombinant Human GABPB2 cell lysate | +Inquiry |
TMEM242-7982HCL | Recombinant Human C6orf35 293 Cell Lysate | +Inquiry |
TCF3-1180HCL | Recombinant Human TCF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All efeU Products
Required fields are marked with *
My Review for All efeU Products
Required fields are marked with *
0
Inquiry Basket