Recombinant Full Length Bacillus Subtilis Branched-Chain Amino Acid Transport Protein Azlc(Azlc) Protein, His-Tagged
Cat.No. : | RFL5011BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Branched-chain amino acid transport protein AzlC(azlC) Protein (O07942) (1-254aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-254) |
Form : | Lyophilized powder |
AA Sequence : | MNKNKESLHLSSPAINTHMNKRSQIWAAFRSAFPYTIPIFAGFLFLGIAYGIFMHSLGFS AIYPIIMSFMIFAGSMEFVAANFLLGAFNPMNALFLTLMVNARHLFYGISMLDKYRGTGK KKLYLIFGMCDESFSINYTANVPANVDKGWFMFFVTLLNHLYWVAGAAIGGIFGSYVKFN TEGLDFVMTALFIVIFIEQWMKEKKHYSALTGLGLSVASLILFGGNQFIIPAMLAILGVL TVLRKPLEKAEVSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | azlC |
Synonyms | azlC; yrdH; BSU26710; Branched-chain amino acid transport protein AzlC |
UniProt ID | O07942 |
◆ Recombinant Proteins | ||
BANF1-959M | Recombinant Mouse BANF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR128-5179H | Recombinant Human GPR128 Protein | +Inquiry |
RFL15975BF | Recombinant Full Length Bacillus Clausii Upf0295 Protein Abc1323(Abc1323) Protein, His-Tagged | +Inquiry |
IL12B-435M | Recombinant Mouse Il12b, LEVLFQ tagged | +Inquiry |
Spike-017V | Recombinant 2019-nCoV Spike RBD(E484K) Protein, His-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
ALB-03C | Native Cynomolgus Monkey ALB protein | +Inquiry |
Lectin-1816P | Active Native Peanut Lectin Protein, Fluorescein labeled | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
GCA-2H | Native Human Gastrointestinal Cancer Antigen | +Inquiry |
ORM1-35H | Native Human Alpha 1 Acid Glycoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTRA4-5328HCL | Recombinant Human HTRA4 293 Cell Lysate | +Inquiry |
PAIP2-3459HCL | Recombinant Human PAIP2 293 Cell Lysate | +Inquiry |
EEF1B2-6714HCL | Recombinant Human EEF1B2 293 Cell Lysate | +Inquiry |
FASTK-6323HCL | Recombinant Human FASTK 293 Cell Lysate | +Inquiry |
ZNF643-2067HCL | Recombinant Human ZNF643 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All azlC Products
Required fields are marked with *
My Review for All azlC Products
Required fields are marked with *
0
Inquiry Basket