Recombinant Full Length Bacillus Subtilis Atp-Binding/Permease Protein Cydc(Cydc) Protein, His-Tagged
Cat.No. : | RFL11984BF |
Product Overview : | Recombinant Full Length Bacillus subtilis ATP-binding/permease protein CydC(cydC) Protein (P94366) (1-567aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-567) |
Form : | Lyophilized powder |
AA Sequence : | MGKDLFRYKGMKRILTLITCLTLIQTAAIIMQAEWLSEAVTGLFNGKGITSLLPVIGFFL IAFIARHGMTVARQKIVYQYAARTGADLRKSFLDQLFRLGPRFAKKEGTGQMVTLAMEGI SQFRRYLELFLPKMVSMAIVPAAVVIYVFFQDRTSAIILVAAMPILIIFMILLGLVAQRK ADRQWKSYQRLSNHFVDSLRGLETLRFLGLSKSHSKNIFYVSERYRKATMSTLRVAFLSS FALDFFTMLSVATVAVFLGLRLIDGDILLGPALTALILAPEYFLPVREVGNDYHATLNGQ EAGKTIQEILSQPGFKEETPLQLEAWSDQDELKLSGVSVGRSVSDIHLSFKGKKKIGIIG ASGAGKSTLIDILGGFLEPDGGMIEVNGTSRSHLQDGSWQKNLLYIPQHPYIFDDTLGNN IRFYHPSASAEDTTRAAASAGLTELVNNLPDGLEGRIGEGGRALSGGQAQRVALARAFLG NRPILLLDEPTAHLDIETEYEIKETMLDLFEDKLVFLATHRLHWMLDMDEIIVLDGGRVA EIGTHNELLEKNGVYTKLVKAQLGERA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cydC |
Synonyms | cydC; yxkM; BSU38740; ATP-binding/permease protein CydC |
UniProt ID | P94366 |
◆ Native Proteins | ||
pepsin -173P | Native Pig pepsin | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
Actin-340R | Native Rabbit Actin Protein | +Inquiry |
BCC-162B | Native Bovine Cholesterol Concentrate | +Inquiry |
Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
BIN3-8452HCL | Recombinant Human BIN3 293 Cell Lysate | +Inquiry |
ZNF596-39HCL | Recombinant Human ZNF596 293 Cell Lysate | +Inquiry |
USP50-1897HCL | Recombinant Human USP50 cell lysate | +Inquiry |
PPFIBP1-2978HCL | Recombinant Human PPFIBP1 293 Cell Lysate | +Inquiry |
RSV-G-2698RCL | Recombinant RSV RSV-G cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cydC Products
Required fields are marked with *
My Review for All cydC Products
Required fields are marked with *
0
Inquiry Basket