Recombinant Full Length Bacillus Pumilus Upf0365 Protein Bpum_2271 (Bpum_2271) Protein, His-Tagged
Cat.No. : | RFL25082BF |
Product Overview : | Recombinant Full Length Bacillus pumilus UPF0365 protein BPUM_2271 (BPUM_2271) Protein (A8FFC3) (1-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Pumilus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-330) |
Form : | Lyophilized powder |
AA Sequence : | MDPSTLLLFVIIAAGLIVLSIFFTFVPVMLWISALAAGVRVSIFTLVGMRLRRVIPNRVV NPLIKAHKAGLDVTINQLESHYLAGGNVDRVVNALIAAQRANIELNFARCAAIDLAGRDV LEAVQMSVNPKVIETPFISGVAMDGIEVKAKARITVRANIERLVGGAGEETIIARVGEGI VSTIGSSNNHKRVLENPDMISQTVLGKGLDSGTAFEILSIDIADVDIGKNIGAILQTDQA EADKNIAQAKAEERRAMAVAQEQEMRAKVEEMRAKVVEAEAEVPLAMAEALREGNIGVMD YMNIKNIDADTDMRDSFGKMTKGPSDNENK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BPUM_2271 |
Synonyms | floA; BPUM_2271; Flotillin-like protein FloA |
UniProt ID | A8FFC3 |
◆ Recombinant Proteins | ||
KRT6A-1093C | Recombinant Chicken KRT6A | +Inquiry |
SYNJ2-8914M | Recombinant Mouse SYNJ2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANK1-3490H | Recombinant Human ANK1, His-tagged | +Inquiry |
ZYG11B-1431H | Recombinant Human ZYG11B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cd34-3313M | Recombinant Mouse Cd34 protein(Met1-Thr287), His-tagged | +Inquiry |
◆ Native Proteins | ||
HBb-49S | Native Sheep Hemoglobin Beta (HBb) Protein | +Inquiry |
TF-135R | Native Rabbit Transferrin | +Inquiry |
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
HP-7761R | Native Rabbit Haptoglobin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFA11-3924HCL | Recombinant Human NDUFA11 293 Cell Lysate | +Inquiry |
ENPP3-001CCL | Recombinant Cynomolgus ENPP3 cell lysate | +Inquiry |
TCTN3-1158HCL | Recombinant Human TCTN3 293 Cell Lysate | +Inquiry |
PCLO-1311HCL | Recombinant Human PCLO cell lysate | +Inquiry |
LNCaP-051HCL | Human LNCaP Cell Nuclear Extract | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BPUM_2271 Products
Required fields are marked with *
My Review for All BPUM_2271 Products
Required fields are marked with *
0
Inquiry Basket