Recombinant Full Length Bacillus Licheniformis Upf0754 Membrane Protein Bli01057/Bl02871(Bli01057, Bl02871) Protein, His-Tagged
Cat.No. : | RFL3375BF |
Product Overview : | Recombinant Full Length Bacillus licheniformis UPF0754 membrane protein BLi01057/BL02871(BLi01057, BL02871) Protein (Q65LU9) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Licheniformis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MYVFGIFAVMIAVGALIGAVTNHFAIKMLFRPYKAIYIFGKRVPFTPGLIPKRRDELARQ MGQMVTGHLLTTEGLKKRLASDAVKSQAVQVGERLLARLSQSTATVEEALESIGISNPAQ KADRAVSRLADEKLTAFLEAYENEPLKKLFPLEAQEKLKEKIPMVSSYILSRAVSYFESD EGKERLGHMIDDFLKERGMLGSMVQMFLGNSSLVDRVQPEIVKFLKNGETAGLLQDLLEN EWDKLKEYTFKEADDKWNLKPLIFDLKEKLLKRFSLQPFFEKTIGSSISSFEQDIALRLP QMADRLLEEAGRRLDQALKQLELEQIVKEQVDNFPVERLEEMVLSISKREFKMITYLGGL LGGIIGAVQAIFVILI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BLi01057 |
Synonyms | BLi01057; BL02871; UPF0754 membrane protein BLi01057/BL02871 |
UniProt ID | Q65LU9 |
◆ Recombinant Proteins | ||
Nol4-4454M | Recombinant Mouse Nol4 Protein, Myc/DDK-tagged | +Inquiry |
DYDC2-6148HF | Recombinant Full Length Human DYDC2 Protein, GST-tagged | +Inquiry |
OGN-914H | Recombinant Human OGN, His-tagged | +Inquiry |
FAM19A4-1289H | Recombinant Human FAM19A4 Protein, MYC/DDK-tagged | +Inquiry |
USP20-787HFL | Active Recombinant Full Length Human USP20 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
E2-01H | Native Human Estradiol (E2) | +Inquiry |
IgG-7439M | Native Mouse IgG Fc Protein | +Inquiry |
Lectin-1782G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Biotinylated | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
RV-17 | Native Rotavirus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHX29-477HCL | Recombinant Human DHX29 cell lysate | +Inquiry |
Pancreas-142R | Rat Pancreas Tissue Lysate | +Inquiry |
ZNF526-58HCL | Recombinant Human ZNF526 293 Cell Lysate | +Inquiry |
CNPY3-7396HCL | Recombinant Human CNPY3 293 Cell Lysate | +Inquiry |
ALDH3B2-59HCL | Recombinant Human ALDH3B2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BLi01057 Products
Required fields are marked with *
My Review for All BLi01057 Products
Required fields are marked with *
0
Inquiry Basket