Recombinant Full Length Bacillus Halodurans Upf0316 Protein Bh0621(Bh0621) Protein, His-Tagged
Cat.No. : | RFL9092BF |
Product Overview : | Recombinant Full Length Bacillus halodurans UPF0316 protein BH0621(BH0621) Protein (Q9KF65) (1-179aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Halodurans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-179) |
Form : | Lyophilized powder |
AA Sequence : | MVSFFMEHALTMILIILIINVVYVTLFTVRMIFTLKNQRYLAATVSMIEIIVYVLGLSLV LDNLDRIENLIAYAVGYGIGVITGMKVEEKLALGYITVNVITKEYEPDIPNTLRDKGYGV TNWVAYGREGERLMMEILTSRKSEADLYATIKKLDPKAFIISHEPKTFFGGFWVKGIRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BH0621 |
Synonyms | BH0621; UPF0316 protein BH0621 |
UniProt ID | Q9KF65 |
◆ Native Proteins | ||
Lectin-1838S | Active Native Sambucus Nigra Lectin Protein, Biotinylated | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
Alb-113R | Native Rat Serum Albumin | +Inquiry |
Annexin-V-011H | Native Human Annexin-V Protein, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTR1B-9052HCL | Recombinant Human ACTR1B 293 Cell Lysate | +Inquiry |
OSTN-3519HCL | Recombinant Human OSTN 293 Cell Lysate | +Inquiry |
ZNF70-23HCL | Recombinant Human ZNF70 293 Cell Lysate | +Inquiry |
GNAI3-5869HCL | Recombinant Human GNAI3 293 Cell Lysate | +Inquiry |
A431-030HCL | Human A431 Cell Nuclear Extract | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BH0621 Products
Required fields are marked with *
My Review for All BH0621 Products
Required fields are marked with *
0
Inquiry Basket