Recombinant Full Length Bacillus Halodurans Sensor Protein Bces(Bces) Protein, His-Tagged
Cat.No. : | RFL31471BF |
Product Overview : | Recombinant Full Length Bacillus halodurans Sensor protein BceS(bceS) Protein (Q9K620) (1-334aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Halodurans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-334) |
Form : | Lyophilized powder |
AA Sequence : | MIKTFIKERGSWILIIIFLQCFTVFIAYLDSAIPLAPVFYSVFLSSMIFLFFLAVRYKKE TTFYRKLEEWDKDLDVTNLAAAESPFERIIEQTIVKQTGYLQEKAHRHETALEQEKDDLL AWIHEIKTPLTAMHLIIDRLEDRTIKGQLTYEWMRIHLLLDQQLHQKRIPFMENDLYVEK VNLESVLHQEIKTLQSWCIQKGIGFDLQLEVTDVLTDAKWLSFILRQLLSNAVKYSEASD IIIKSDVVSGKTVVEVTDFGRGIEPKDLPRIFEKGFTSTKTDQTNGATGMGLYLAKRVAE PLLIDLAVSSTVGEGTTFTLTFPKENEFVRTLGM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bceS |
Synonyms | bceS; BH3912; Sensor protein BceS |
UniProt ID | Q9K620 |
◆ Native Proteins | ||
F10-355H | Native Human Coagulation factor X, APC conjugated | +Inquiry |
SAP6-91 | Active Native Saponaria Officinalis SAP6 | +Inquiry |
SERPINA3-8008H | Native Human Serum Alpha 1-AntiChymoTrypsin | +Inquiry |
CA6-804H | Native Human CA6 | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR2E3-3711HCL | Recombinant Human NR2E3 293 Cell Lysate | +Inquiry |
RBMS1-2462HCL | Recombinant Human RBMS1 293 Cell Lysate | +Inquiry |
MGMT-1109HCL | Recombinant Human MGMT cell lysate | +Inquiry |
LAX1-4812HCL | Recombinant Human LAX1 293 Cell Lysate | +Inquiry |
HA-2348HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All bceS Products
Required fields are marked with *
My Review for All bceS Products
Required fields are marked with *
0
Inquiry Basket