Recombinant Full Length Bacillus Cereus Upf0344 Protein Bce33L1051(Bce33L1051) Protein, His-Tagged
Cat.No. : | RFL17093BF |
Product Overview : | Recombinant Full Length Bacillus cereus UPF0344 protein BCE33L1051(BCE33L1051) Protein (Q63EL0) (1-120aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus cereus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-120) |
Form : | Lyophilized powder |
AA Sequence : | MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGVWLYLDQTIVDKS YHMWYGLKMLAGILVIAGMEMVLVKMSKNKATGAFWGLFIIALVAVFYLGLKLPIGWQVF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BCE33L1051 |
Synonyms | BCE33L1051; UPF0344 protein BCE33L1051 |
UniProt ID | Q63EL0 |
◆ Recombinant Proteins | ||
FLT1-1576HFL | Recombinant Full Length Human FLT1 Protein, C-Flag-tagged | +Inquiry |
OLFR492-11740M | Recombinant Mouse OLFR492 Protein | +Inquiry |
MCAM-2039H | Recombinant Human MCAM protein, His-tagged | +Inquiry |
GCNT1-27452TH | Recombinant Human GCNT1 | +Inquiry |
CYP2C9-1151R | Recombinant Rhesus monkey CYP2C9 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGB-59R | Native Rabbit Fibrinogen | +Inquiry |
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
toxB-11C | Native C. difficile toxB | +Inquiry |
KRT19-382H | Native Human KRT19 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RECQL-2430HCL | Recombinant Human RECQL 293 Cell Lysate | +Inquiry |
KLK14-4902HCL | Recombinant Human KLK14 293 Cell Lysate | +Inquiry |
MYD88-4034HCL | Recombinant Human MYD88 293 Cell Lysate | +Inquiry |
Fetal Skin-162H | Human Fetal Skin Lysate | +Inquiry |
KIF19-926HCL | Recombinant Human KIF19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCE33L1051 Products
Required fields are marked with *
My Review for All BCE33L1051 Products
Required fields are marked with *
0
Inquiry Basket