Recombinant Full Length Bacillus Cereus Quinol Oxidase Subunit 2(Qoxa) Protein, His-Tagged
Cat.No. : | RFL11698BF |
Product Overview : | Recombinant Full Length Bacillus cereus Quinol oxidase subunit 2(qoxA) Protein (Q73DE0) (29-291aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus cereus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (29-291) |
Form : | Lyophilized powder |
AA Sequence : | LAVLNPQGPVAKAQYDLIVWSFLLMSLIIAIVFILFTVILIRYREKPENMDYEPPEQHGN TLLEIIWTLVPVIIVIALSIPTVKATYASEEVPKESKHIKPVEIYVTSANWKWLFSYPEE KIETVNYLNIPAGVPIQFKLTSVGPMNAFWVPELGGMKYTMDGMIMDLYLQADKPGSYLG RSANFSGEGFTHMEFEVEAKTKEKYDKWVKEVQQTAPKLTEDKYNEIVKPGVVGRMTFSS HHLSYVDPKSLEYCDYNYYKNKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | qoxA |
Synonyms | qoxA; BCE_0772; Quinol oxidase subunit 2; Cytochrome aa(3 subunit 2; Quinol oxidase polypeptide II |
UniProt ID | Q73DE0 |
◆ Native Proteins | ||
GCT-007H | Native Human Gamma glutamyl transferases Protein | +Inquiry |
Bilirubin-156P | Native Porcine Bilirubin | +Inquiry |
Pertussis-37 | Native Pertussis Toxin Antigen | +Inquiry |
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
Tnni2-7429M | Native Mouse Tnni2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEX10-3296HCL | Recombinant Human PEX10 293 Cell Lysate | +Inquiry |
SW620-019WCY | Human Colon Adenocarcinoma SW620 Whole Cell Lysate | +Inquiry |
TSEN54-704HCL | Recombinant Human TSEN54 lysate | +Inquiry |
GATAD1-6008HCL | Recombinant Human GATAD1 293 Cell Lysate | +Inquiry |
SYN3-1730HCL | Recombinant Human SYN3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All qoxA Products
Required fields are marked with *
My Review for All qoxA Products
Required fields are marked with *
0
Inquiry Basket