Recombinant Full Length Bacillus Cereus Glycerol-3-Phosphate Acyltransferase 1(Plsy1) Protein, His-Tagged
Cat.No. : | RFL13247BF |
Product Overview : | Recombinant Full Length Bacillus cereus Glycerol-3-phosphate acyltransferase 1(plsY1) Protein (Q81DG8) (1-182aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus cereus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-182) |
Form : | Lyophilized powder |
AA Sequence : | MINSMQFLYLVASYLIGNILTAYIVTKLRHNVDIRDEGSGNPGARNMGRVYGKGYFIATF LGDAIKGAIVVAVAKYLFEDPTFVMLTLLAVIIGHIYPVLFKGKGGKGISTFIGGLIAFD YLIALTLLGIFIVFYLIFKGFTKPGLITIACLPICMILYSYSIVTTILSGIIIVLILYVN RE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | plsY1 |
Synonyms | plsY1; BC_2398; Glycerol-3-phosphate acyltransferase 1; Acyl-PO4 G3P acyltransferase 1; Acyl-phosphate--glycerol-3-phosphate acyltransferase 1; G3P acyltransferase 1; GPAT 1; Lysophosphatidic acid synthase 1; LPA synthase 1 |
UniProt ID | Q81DG8 |
◆ Recombinant Proteins | ||
Gpx3-8202M | Recombinant Mouse Gpx3 protein, His & T7-tagged | +Inquiry |
MMR-1611B | Recombinant Bacillus subtilis MMR protein, His-tagged | +Inquiry |
SPATA31D3-1469H | Recombinant Human SPATA31D3 | +Inquiry |
HA-3255V | Recombinant Influenza A H9N2 (A/duck/Hong Kong/448/78) HA protein(Met1-Lys523), His-tagged | +Inquiry |
RFL30709PF | Recombinant Full Length Cytochrome C Oxidase Subunit 2 Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LTF-229B | Native Bovine Lactoferrin | +Inquiry |
C3-001C | Active Native C. botulinum C3 Enzyme | +Inquiry |
FGA-79H | Active Native Human Fibrinogen | +Inquiry |
Angiostatin K1-4-22H | Native Human Angiostatin K1-4 Protein | +Inquiry |
MUC16-1H | Native Human MUC16 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TREM2-2186MCL | Recombinant Mouse TREM2 cell lysate | +Inquiry |
TAX1BP1-1737HCL | Recombinant Human TAX1BP1 cell lysate | +Inquiry |
NBAS-3958HCL | Recombinant Human NBAS 293 Cell Lysate | +Inquiry |
GSDMA-5727HCL | Recombinant Human GSDMA 293 Cell Lysate | +Inquiry |
SLC26A6-1752HCL | Recombinant Human SLC26A6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All plsY1 Products
Required fields are marked with *
My Review for All plsY1 Products
Required fields are marked with *
0
Inquiry Basket