Recombinant Full Length Bacillus Cereus Antiholin-Like Protein Lrgb(Lrgb) Protein, His-Tagged
Cat.No. : | RFL5604BF |
Product Overview : | Recombinant Full Length Bacillus cereus Antiholin-like protein LrgB(lrgB) Protein (B7JIF5) (1-230aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus cereus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-230) |
Form : | Lyophilized powder |
AA Sequence : | MASTMTPYFGIVVSLIAYGIGTLLFKHSKGFFLFTPLFVAMVLGIVFLKVGNFTFEEYNT GGKMISFFLEPATIAFAIPLYKQVDKLKKYWWQILSAIVVGSICSVIVVFIVAKAIGLDT AVMNSMLPQAATTAIALPISESIGGIPAITSFAVIFNAVIVYALGALFLKTFRVKHPIAK GLALGTAGHALGVAVGIEMGEVEAAMASIAVTVVGVVTVVVIPMFMPFIG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lrgB |
Synonyms | lrgB; BCAH820_5534; Antiholin-like protein LrgB |
UniProt ID | B7JIF5 |
◆ Recombinant Proteins | ||
CDX2-27917TH | Recombinant Human CDX2 | +Inquiry |
PLAA-11966Z | Recombinant Zebrafish PLAA | +Inquiry |
GPIHBP1-674H | Recombinant Human GPIHBP1 Protein, Fc-tagged | +Inquiry |
GRB2-1997H | Recombinant Human GRB2 protein, His-tagged | +Inquiry |
RFL10011EF | Recombinant Full Length Upf0266 Membrane Protein Yobd(Yobd) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
B. pertussis-36 | Native B. pertussis Filamentous Hemagglutinin Antigen | +Inquiry |
BPI-182H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
Collagen-325H | Native Human Collagen Type I | +Inquiry |
FSHB-P051H | Native Human Follicle Stimulating Hormone therapeutic protein(Urofollitropin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CGB5-776HCL | Recombinant Human CGB5 cell lysate | +Inquiry |
TLK2-001HCL | Recombinant Human TLK2 cell lysate | +Inquiry |
TUBB2A-651HCL | Recombinant Human TUBB2A 293 Cell Lysate | +Inquiry |
C2orf83-8061HCL | Recombinant Human C2orf83 293 Cell Lysate | +Inquiry |
SCN2B-975HCL | Recombinant Human SCN2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lrgB Products
Required fields are marked with *
My Review for All lrgB Products
Required fields are marked with *
0
Inquiry Basket