Recombinant Full Length Bacillus Cereus Antiholin-Like Protein Lrga(Lrga) Protein, His-Tagged
Cat.No. : | RFL20163BF |
Product Overview : | Recombinant Full Length Bacillus cereus Antiholin-like protein LrgA(lrgA) Protein (B7HGA2) (1-143aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus cereus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-143) |
Form : | Lyophilized powder |
AA Sequence : | MSTKKVYSFLSQAFIFSAIMLISNIIATHLPIPMPSSVIGLVILFSLLCLKVIKLEQVES LGTALTGIIGFLFVPSGISVINSLGVMGQYFVQILTVIVVATVILLAVTGLFAQFILGKD EKETEDTKELKVVNKGRKHGKVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lrgA |
Synonyms | lrgA; BCB4264_A5564; Antiholin-like protein LrgA |
UniProt ID | B7HGA2 |
◆ Native Proteins | ||
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
KLKB1-210H | Active Native Human Kallikrein | +Inquiry |
TNNT2-4655H | Native Human Troponin T Type 2 (Cardiac) | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEXI-6968HCL | Recombinant Human DEXI 293 Cell Lysate | +Inquiry |
EMG1-6611HCL | Recombinant Human EMG1 293 Cell Lysate | +Inquiry |
BMPR1A-2145HCL | Recombinant Human BMPR1A cell lysate | +Inquiry |
SNAPIN-1635HCL | Recombinant Human SNAPIN 293 Cell Lysate | +Inquiry |
SYVN1-1296HCL | Recombinant Human SYVN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lrgA Products
Required fields are marked with *
My Review for All lrgA Products
Required fields are marked with *
0
Inquiry Basket