Recombinant Full Length Bacillus Anthracis Upf0397 Protein Bameg_1951 (Bameg_1951) Protein, His-Tagged
Cat.No. : | RFL25993BF |
Product Overview : | Recombinant Full Length Bacillus anthracis UPF0397 protein BAMEG_1951 (BAMEG_1951) Protein (C3LH78) (1-182aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus anthracis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-182) |
Form : | Lyophilized powder |
AA Sequence : | MNRLSTKLVVAIGIGSALYGILGLWGFSIAPNTFIKPALAILTVFGALFGPVAGLLIGLI GHTVTDTIAGWSIWWGWVISSGIIGFTMGFIQKRVGFSVKNGTYNKGDISYLAITGLIGI VIAIIFAGAFDIIVMGEPFDKIVIQVLGATIADVIVFLVLGLPITIGLAKSNKKHTHLKI EK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BAMEG_1951 |
Synonyms | BAMEG_1951; UPF0397 protein BAMEG_1951 |
UniProt ID | C3LH78 |
◆ Recombinant Proteins | ||
BPIFB3-388R | Recombinant Rhesus Macaque BPIFB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
JAKMIP2-2329R | Recombinant Rhesus monkey JAKMIP2 Protein, His-tagged | +Inquiry |
Xrcc6-449R | Recombinant Rat Xrcc6 Protein, His-tagged | +Inquiry |
RFL28518DF | Recombinant Full Length Danio Rerio Protein Tweety Homolog 2-Like(Ttyh2L) Protein, His-Tagged | +Inquiry |
Ifi30-3476M | Recombinant Mouse Ifi30 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Cry1Ab-36B | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
Stomach-004H | Human Stomach Lysate, Total Protein | +Inquiry |
pla2-839S | Active Native Snake Phospholipase A2 protein | +Inquiry |
C3-147C | Active Native Botulinum C3 Enzyme | +Inquiry |
Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2353HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
ASB2-40HCL | Recombinant Human ASB2 lysate | +Inquiry |
EPHX2-6585HCL | Recombinant Human EPHX2 293 Cell Lysate | +Inquiry |
CHMP2B-185HCL | Recombinant Human CHMP2B lysate | +Inquiry |
CMV-644HCL | Native Cytomegalovirus Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BAMEG_1951 Products
Required fields are marked with *
My Review for All BAMEG_1951 Products
Required fields are marked with *
0
Inquiry Basket