Recombinant Full Length Azorhizobium Caulinodans Sensor Protein Fixl(Fixl) Protein, His-Tagged
Cat.No. : | RFL35003AF |
Product Overview : | Recombinant Full Length Azorhizobium caulinodans Sensor protein fixL(fixL) Protein (P26489) (1-504aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Azorhizobium caulinodans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-504) |
Form : | Lyophilized powder |
AA Sequence : | MTDTPTQALPPKAPQAGPTVPGTVRRAVPGSAAAALVIAASHFAALSAFDPRILLVLLVI VVLASSGGLFAGLAATAVSALGLALRGLLSGDTVVADWQSLGLLTIAGAGIAVLGERLRR TRLDAVARDRALLAREAHLSSILDTVPDAMIVIDERGIMQSFSITAERLFGYSPSEVIGR NVSMLMPNPHRDQHDLYLSRYLTTGERRIIGIGRVVTGERKDGATFPMELAVGEMHSVSG RFFTGFIRDLTERQNTEARLQELQAELVHISRLTALGEMASTLAHELNQPLSAIANYIKG SRRLLDDGDPKRIPMLQGALDKAAEQALRAGQIIRRLRDFVSRGETERRVESLSKLIEEA SALALVGAKEHGIQVRYQIDTSCDLVLADKVQVQQVLLNLMRNALEAMMDASRRQLLVQT TPAEDDMVTVSVCDTGHGISDEMRAQLFTPFVTTKAQGMGVGLSISRTIIEAHGGRIWAE PNAGGGTIFRFTLRTVDEEAMNDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fixL |
Synonyms | fixL; AZC_4654; Sensor protein FixL |
UniProt ID | P26489 |
◆ Recombinant Proteins | ||
Cyp2s1-2419M | Recombinant Mouse Cyp2s1 Protein, Myc/DDK-tagged | +Inquiry |
DCP1B-878HFL | Recombinant Full Length Human DCP1B Protein, C-Flag-tagged | +Inquiry |
H2AFY-2430R | Recombinant Rat H2AFY Protein, His (Fc)-Avi-tagged | +Inquiry |
MINPP1-1158H | Recombinant Human MINPP1 Protein (31-487 aa), GST-tagged | +Inquiry |
Entpd7-2837M | Recombinant Mouse Entpd7 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
gp125-261V | Native EBV Viral Capsid gp125 Protein | +Inquiry |
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
Batroxobin-99 | Native Bothrops atrox snake venom Batroxobin Protein | +Inquiry |
LYZ-139C | Native Chicken lysozyme | +Inquiry |
LTF-230B | Native Bovine Apo-Lactoferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANLN-8845HCL | Recombinant Human ANLN 293 Cell Lysate | +Inquiry |
CBFB-7815HCL | Recombinant Human CBFB 293 Cell Lysate | +Inquiry |
NOXO1-3747HCL | Recombinant Human NOXO1 293 Cell Lysate | +Inquiry |
ZFYVE28-1981HCL | Recombinant Human ZFYVE28 cell lysate | +Inquiry |
TMEM199-974HCL | Recombinant Human TMEM199 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fixL Products
Required fields are marked with *
My Review for All fixL Products
Required fields are marked with *
0
Inquiry Basket