Recombinant Full Length Human DCP1B Protein, C-Flag-tagged
Cat.No. : | DCP1B-878HFL |
Product Overview : | Recombinant Full Length Human DCP1B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of a family of proteins that function in removing the 5' cap from mRNAs, which is a step in regulated mRNA decay. This protein localizes to cytoplasmic foci which are the site of mRNA breakdown and turnover. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.5 kDa |
AA Sequence : | MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLFVYTRSASPKH GFTIMNRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEECQRIAELMKNLTQYEQLKAHQ GTGAGISPVILNSGEGKEVDILRMLIKAKDEYTKCKTCSEPKKITSSSAIYDNPNLIKPIPVKPSENQQQ RIPQPNQTLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQQEKLPIRQGVVRSLSYEEP RRHSPPIEKQLCPAIQKLMVRSADLHPLSELPENRPCENGSTHSAGEFFTGPVQPGSPHNIGTSRGVQNA SRTQNLFEKLQSTPGAANKCDPSTPAPASSAALNRSRAPTSVTPVAPGKGLAQPPQAYFNGSLPPQTVGH QAHGREQSTLPRQTLAISGSQTGSSGVISPQELLKKLQIVQQEQQLHASNRPALAAKFPVLAQSSGTGKP LESWINKTPNTEQQTPLFQVISPQRIPATAAPSLLMSPMVFAQPTSVPPKERESGLLPVGGQEPPAAATS LLLPIQSPEPSVITSSPLTKLQLQEALLYLIQNDDNFLNIIYEAYLFSMTQAAMKKTMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | RNA degradation |
Full Length : | Full L. |
Gene Name | DCP1B decapping mRNA 1B [ Homo sapiens (human) ] |
Official Symbol | DCP1B |
Synonyms | DCP1 |
Gene ID | 196513 |
mRNA Refseq | NM_152640.5 |
Protein Refseq | NP_689853.3 |
MIM | 609843 |
UniProt ID | Q8IZD4 |
◆ Recombinant Proteins | ||
DCP1B-727H | Recombinant Human DCP1B Protein, His (Fc)-Avi-tagged | +Inquiry |
Dcp1b-2477M | Recombinant Mouse Dcp1b Protein, Myc/DDK-tagged | +Inquiry |
DCP1B-2075H | Recombinant Human DCP1B Protein (2-617 aa), His-tagged | +Inquiry |
DCP1B-878HFL | Recombinant Full Length Human DCP1B Protein, C-Flag-tagged | +Inquiry |
DCP1B-2401H | Recombinant Human DCP1B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCP1B-7047HCL | Recombinant Human DCP1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCP1B Products
Required fields are marked with *
My Review for All DCP1B Products
Required fields are marked with *
0
Inquiry Basket