Recombinant Full Length Autographa Californica Nuclear Polyhedrosis Virus Major Envelope Glycoprotein(Gp64) Protein, His-Tagged
Cat.No. : | RFL11173AF |
Product Overview : | Recombinant Full Length Autographa californica nuclear polyhedrosis virus Major envelope glycoprotein(GP64) Protein (P17501) (21-512aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | AcMNPV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-512) |
Form : | Lyophilized powder |
AA Sequence : | AEHCNAQMKTGPYKIKNLDITPPKETLQKDVEITIVETDYNENVIIGYKGYYQAYAYNGG SLDPNTRVEETMKTLNVGKEDLLMWSIRQQCEVGEELIDRWGSDSDDCFRDNEGRGQWVK GKELVKRQNNNHFAHHTCNKSWRCGISTSKMYSRLECQDDTDECQVYILDAEGNPINVTV DTVLHRDGVSMILKQKSTFTTRQIKAACLLIKDDKNNPESVTREHCLIDNDIYDLSKNTW NCKFNRCIKRKVEHRVKKRPPTWRHNVRAKYTEGDTATKGDLMHIQEELMYENDLLKMNI ELMHAHINKLNNMLHDLIVSVAKVDERLIGNLMNNSVSSTFLSDDTFLLMPCTNPPAHTS NCYNNSIYKEGRWVANTDSSQCIDFSNYKELAIDDDVEFWIPTIGNTTYHDSWKDASGWS FIAQQKSNLITTMENTKFGGVGTSLSDITSMAEGELAAKLTSFMFGHVVNFVIILIVILF LYCMIRNRNRQY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GP64 |
Synonyms | GP64; GP67; ORF128; Major envelope glycoprotein; gp64 |
UniProt ID | P17501 |
◆ Native Proteins | ||
PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
IgG-017R | Native Rabbit IgG Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
VTN-386R | Native Rabbit Vitronectin | +Inquiry |
PLG-54H | Native Human glu-Plasminogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
UST-450HCL | Recombinant Human UST 293 Cell Lysate | +Inquiry |
RAB35-2604HCL | Recombinant Human RAB35 293 Cell Lysate | +Inquiry |
HA-2663HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
TRDD3-1819HCL | Recombinant Human TRDD3 cell lysate | +Inquiry |
DHRS9-6934HCL | Recombinant Human DHRS9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GP64 Products
Required fields are marked with *
My Review for All GP64 Products
Required fields are marked with *
0
Inquiry Basket