Recombinant Full Length Atropa Belladonna Photosystem I Assembly Protein Ycf4(Ycf4) Protein, His-Tagged
Cat.No. : | RFL32398AF |
Product Overview : | Recombinant Full Length Atropa belladonna Photosystem I assembly protein Ycf4(ycf4) Protein (Q8S8W6) (1-184aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Atropa belladonna (Belladonna) (Deadly nightshade) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-184) |
Form : | Lyophilized powder |
AA Sequence : | MTWRSEHIWIELITGSRKISNFCWAFILFLGSLGFLLVGTSSYLGRNLISFFPTQQIVFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRF LIKDIQSVRIEVKEGISARRVLYMDIRGQGSIPLTRTDENLTPREIEQKAAELAYFLRVP IEVF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ycf4 |
Synonyms | ycf4; Photosystem I assembly protein Ycf4 |
UniProt ID | Q8S8W6 |
◆ Native Proteins | ||
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
TF-002H | Native Human TF Protein, Rhodamine Conjugated | +Inquiry |
IgA-252H | Native Human Immunoglobulin A | +Inquiry |
CKMB-256H | Active Native Human CKMB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TULP4-637HCL | Recombinant Human TULP4 293 Cell Lysate | +Inquiry |
CDK6-7622HCL | Recombinant Human CDK6 293 Cell Lysate | +Inquiry |
HAVCR2-995MCL | Recombinant Mouse HAVCR2 cell lysate | +Inquiry |
Uterus-868R | Mini Rabbit Uterus Membrane Lysate, Total Protein | +Inquiry |
IRF1-5168HCL | Recombinant Human IRF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ycf4 Products
Required fields are marked with *
My Review for All ycf4 Products
Required fields are marked with *
0
Inquiry Basket