Recombinant Full Length Aspergillus Terreus Patatin-Like Phospholipase Domain-Containing Protein Ateg_02594(Ateg_02594) Protein, His-Tagged
Cat.No. : | RFL3068AF |
Product Overview : | Recombinant Full Length Aspergillus terreus Patatin-like phospholipase domain-containing protein ATEG_02594(ATEG_02594) Protein (Q0CUP0) (1-715aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aspergillus terreus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-715) |
Form : | Lyophilized powder |
AA Sequence : | MTDSAIGNVYDPRALPDYDREFIHPDDLRRFENALNDQDVLPLVALNDWRPVYQRVRKTR GRRKEPRRTKDETREGVLYTVLKWPFLAFVLGWISFLGVAYILTRFYIFIYEQWVSWRGK RQSLRKQLYVQTNYRDWLKAAEALDAHLGNHAWKEIDENAYYDHITINKLVSQLRKLRQD AEWEMHHEQVNAAESPAVEELCTILEACVKNNFAGVENPRLYSETYSGTKVLVQEYVDEV KACLELVAESKQISDEDKYHHFKHLDTNFGRTALCLSGGATFAYYHFGVVRALLDNNVLP EIITGTSGGALVAALVATRTDEELKQLLVPALAHRIRACHEGFTTWVRRWWRTGARFDTL EWARQCSWFCRGSTTFREAYERTGRILNVSCVPSDPHSPTILANYLTSPNCVIWSAVLAS AAVPGILNPVVLMTKKRDGTLAPYSFGHKWKDGSLRTDIPIKALNLHFNVNFTIVSQVNP HINLFFFSSRGAVGRPVTHRKGRGWRGGFLGSAIEQYIKLDMNKWLRVLRHLELLPRPMG QDWSEIWLQKFSGTVTIWPKTVPSDFYYILSDPTPERLARMIHMGQQSAFPKIQFIKNRL KIEYAIIKGLQQTAPRGGGRATSPTQLRLRNGHGNGPVNPIDERLDQNLPERTGEYSKEA DANSAEMSDSSGVDSATASALREARHPRRNSMLVEMQRQSAVFFDDVDSDTWKGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATEG_02594 |
Synonyms | ATEG_02594; Patatin-like phospholipase domain-containing protein ATEG_02594 |
UniProt ID | Q0CUP0 |
◆ Recombinant Proteins | ||
Fut1-3108M | Recombinant Mouse Fut1 Protein, Myc/DDK-tagged | +Inquiry |
ERC1-4526HF | Recombinant Full Length Human ERC1 Protein, GST-tagged | +Inquiry |
Mrpl38-4155M | Recombinant Mouse Mrpl38 Protein, Myc/DDK-tagged | +Inquiry |
RFL6217EF | Recombinant Full Length Escherichia Coli Zinc Transport Protein Zntb(Zntb) Protein, His-Tagged | +Inquiry |
NOL3-209H | Recombinant Human NOL3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
APOC3-669H | Native Human APOC3 protein | +Inquiry |
ctxA-145V | Native Cholera Toxin A | +Inquiry |
PLG-30880TH | Native Human PLG | +Inquiry |
PR-01H | Native HIV1 PR Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXD8-5410HCL | Recombinant Human HOXD8 293 Cell Lysate | +Inquiry |
RRP15-2142HCL | Recombinant Human RRP15 293 Cell Lysate | +Inquiry |
Skin-440H | Human Skin Liver Cirrhosis Lysate | +Inquiry |
C6orf114-8001HCL | Recombinant Human C6orf114 293 Cell Lysate | +Inquiry |
SIGIRR-1091HCL | Recombinant Human SIGIRR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATEG_02594 Products
Required fields are marked with *
My Review for All ATEG_02594 Products
Required fields are marked with *
0
Inquiry Basket