Recombinant Full Length Ashbya Gossypii Ph-Response Regulator Protein Palh/Rim21(Rim21) Protein, His-Tagged
Cat.No. : | RFL20707AF |
Product Overview : | Recombinant Full Length Ashbya gossypii pH-response regulator protein palH/RIM21(RIM21) Protein (Q758G4) (1-502aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-502) |
Form : | Lyophilized powder |
AA Sequence : | MVQRTRWRYSAIAHNYNSCRPMELGAGIAVGAWDGVWARARSAEFVAATDMGDPVYSAFM RYDDSAPLHAAVAADWATYVAADFNGGPFKYSIFPILYSFTASLVVTMGLTVIVFFNVRT KPHRGVPKLLRVAAVLACGNLLTFVVRAMMQLGRDHAEGVVPMNHILDMLWTDTAFNTVD ILAVLILQLCQVQTVMRFFTRFQEKRLISLCGILLAVLSQVLWAIPPYSEAVSNHFMPLD DDKDMDVLPPFVYLVRIAQAGSYASFVLMHVFAKKKLCVQSVQMFLLTVLTVVVVVLQPA FFITDVTNVWIDNLSEIFSTTCYMGSTVIVWEWSNRLSILEARRQAQSILGRPVYEDEEQ GYNFARYALKIQTALTSKSDEGDTTSATTFAAPRSARFEGKGGPQSPVYVQEGEQQAVMA FNKRMGTRALAHHVLDSIIYYTDKVVVKGLGNLSASLPSKTSSATSVRGRVRKRIGLEGA NDVFVYRTKDLVFDSDEDIPRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RIM21 |
Synonyms | RIM21; PAL2; AEL202C; pH-response regulator protein palH/RIM21 |
UniProt ID | Q758G4 |
◆ Recombinant Proteins | ||
ART5-810R | Recombinant Rat ART5 Protein | +Inquiry |
GRIA3-1352H | Recombinant Human GRIA3 protein, His & T7-tagged | +Inquiry |
CLEC10A-3684H | Recombinant Human CLEC10A protein, His-tagged | +Inquiry |
CITED1-1701M | Recombinant Mouse CITED1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAPRIN1-1127R | Recombinant Rat CAPRIN1 Protein | +Inquiry |
◆ Native Proteins | ||
IgE-507H | Native Human IgE protein | +Inquiry |
AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
ctxB-146V | Native Cholera Toxin B | +Inquiry |
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH5-225H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPP1-4233HCL | Recombinant Human MPP1 293 Cell Lysate | +Inquiry |
SQRDL-1482HCL | Recombinant Human SQRDL 293 Cell Lysate | +Inquiry |
DHRS1-6941HCL | Recombinant Human DHRS1 293 Cell Lysate | +Inquiry |
SNCAIP-1633HCL | Recombinant Human SNCAIP 293 Cell Lysate | +Inquiry |
TSPAN2-708HCL | Recombinant Human TSPAN2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RIM21 Products
Required fields are marked with *
My Review for All RIM21 Products
Required fields are marked with *
0
Inquiry Basket