Recombinant Full Length Ashbya Gossypii Nuclear Control Of Atpase Protein 2(Nca2) Protein, His-Tagged
Cat.No. : | RFL8907AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Nuclear control of ATPase protein 2(NCA2) Protein (Q753J1) (1-569aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-569) |
Form : | Lyophilized powder |
AA Sequence : | MIASRYVASELESVTRKLELQLYERAAISEVLEQTSTDLELAKANEVLQTIKEEADACVA AINGGQKFYTIKYDQILSGLESLSGGQWSVGSPLEPLIRDGISDYLHILLYYALLSKNLA KLPQLLLDQEYYGHVSRCSWFMRLFYGLQIMPVKLIEFFRGHALQELPSKLRQTLRIHNF QLVGLPTQRAWQWTKLPIAMVDTDIIQKTASLDSQLDINVKKFGKLLREFPRQKSDRLEV LSDFLDLKPGSSEFAVVRAVQKWNVDSCAPQPNWIVRYWPTILIALAGGPAGIAAIWNAR NDIAAFIKHNLFEFARDLVKNWLVEPLRNIWSTVHHDPTSSIAIMSQGTLDTEINSLQRM LIDFLKEHEYANTVDTSVLMKEIEQGNLTQFMEIYEAQLRKPIRNLVTGDLIRSLLIQIQ KGKVDGSLAIHGIDKLLQSQQLVFGIVSISPALLILYVLCNSLTKLVKYGTVWSKGAKYR RSVSVSLNNVERLLNSPIEEFDGDKGNWNLGLLTLEMANLREYGAKLVPHSRTAEWCRDI DEMASSSALSTTGKLNVINRIYHVYGKYF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NCA2 |
Synonyms | NCA2; AFR321C; Nuclear control of ATPase protein 2 |
UniProt ID | Q753J1 |
◆ Recombinant Proteins | ||
FCGR2B-403H | Recombinant Human FCGR2B Protein, His-tagged | +Inquiry |
LIN28A-5089M | Recombinant Mouse LIN28A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL246CF | Recombinant Full Length Probable Cardiolipin Synthase 1(Crls-1) Protein, His-Tagged | +Inquiry |
PUS3-1744H | Recombinant Human PUS3 | +Inquiry |
RPS9-14505M | Recombinant Mouse RPS9 Protein | +Inquiry |
◆ Native Proteins | ||
IgG-007G | Native Goat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
IgG-05T | Native Toxoplasma gondii IgG antigen, RH strain | +Inquiry |
AMY1A-8023H | Native Human Salivary Amylase (Alpha) | +Inquiry |
Complement C3c-49H | Native Human Complement C3c | +Inquiry |
TG-121B | Native Bovine TG | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBXN2A-539HCL | Recombinant Human UBXN2A 293 Cell Lysate | +Inquiry |
SCFD1-2041HCL | Recombinant Human SCFD1 293 Cell Lysate | +Inquiry |
NAP1L1-3977HCL | Recombinant Human NAP1L1 293 Cell Lysate | +Inquiry |
CAV2-7820HCL | Recombinant Human CAV2 293 Cell Lysate | +Inquiry |
IFNA8-1022CCL | Recombinant Cynomolgus IFNA8 Overexpression Lysate(Met1-Glu189) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NCA2 Products
Required fields are marked with *
My Review for All NCA2 Products
Required fields are marked with *
0
Inquiry Basket