Recombinant Human FCGR2B Protein, His-tagged

• Cat.No.: FCGR2B-403H
• Product Overview: Recombinant Human FCGR2B, transcript variant 4, fused with His tag at C-terminal was expressed in HEK293.

Specification

• Description: The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• Molecular Mass: 20.64kD
• AA Sequence: TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: FCGR2B Fc fragment of IgG, low affinity IIb, receptor (CD32) [ Homo sapiens ]
• Official Symbol: FCGR2B
• Synonyms: FCGR2B; Fc fragment of IgG, low affinity IIb, receptor (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32) , FCG2, FCGR2; low affinity immunoglobulin gamma Fc region receptor II-b; CD32; CD32B; CDw32; fcRII-b; Fc gamma RIIb; fc-gamma-RIIb; fc-gamma RII-b; igG Fc receptor II-b; Fc fragment of IgG, low affinity II, receptor for (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32); FCG2; FCGR2; IGFR2
• Gene ID: 2213
• mRNA Refseq: NM_001002273
• Protein Refseq: NP_001002273
• MIM: 604590
• UniProt ID: P31994