Recombinant Full Length Ashbya Gossypii Mitochondrial Import Inner Membrane Translocase Subunit Tim50(Tim50) Protein, His-Tagged
Cat.No. : | RFL35816AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Mitochondrial import inner membrane translocase subunit TIM50(TIM50) Protein (Q75A73) (10-476aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (10-476) |
Form : | Lyophilized powder |
AA Sequence : | ATSARQLPRVAGLLAGAAAVRSRTYIGTRILHEEQKPKKPEPPNSILTEDMLARAGVDAE RGPETEKAPAEDKAGESTETGSGAGKKKRARKTTTEIKRERYANLFYLFSLTGLAGGAVY MSRDWDADEPEEERKGIENGYTPGLMYRRFKARFDSLFTFFQEPPYPDLLPPPTSPSYQR PLTLVLPLEDFFVHFEWTQQYGWRTVIRPGADYLLGYLSDYYENVLFPSNYMVYSKKVVE KLDPIRAFITYNLFKDHCVYKDGIHIKDLSHLNRDLGKTLIIDTDPNSVKLQMENAILAE PWDGKADDALLRYIPFLEYLVTQPINDVRPILNSFKDRHHIPEEFAERVEKLRAKFNADQ KAKAGSGLSFLLNPGMASKPAKFPLDLIREEGEKNYVRFMKLIEEEKEKLKLQQEHMSAP TFTLKDMAEGNMPTPEEQMKMQLQKQKEFEELYEKEKQKMQQQTKGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TIM50 |
Synonyms | TIM50; ADR045W; Mitochondrial import inner membrane translocase subunit TIM50 |
UniProt ID | Q75A73 |
◆ Recombinant Proteins | ||
TWSG1-162T | Active Recombinant Human TWSG1 Protein (211 aa), His-tagged | +Inquiry |
LEPREL1-1120C | Recombinant Chicken LEPREL1 | +Inquiry |
TM7SF3-9248M | Recombinant Mouse TM7SF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKAR1B-4392H | Recombinant Human PRKAR1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TPIA-3826S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 TPIA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F2-73R | Native Rat Prothrombin | +Inquiry |
FGA-42D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
Lectin-1771D | Active Native Dolichos Biflorus Lectin Protein | +Inquiry |
F10-296M | Active Native Mouse Factor Xa | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO8-6288HCL | Recombinant Human FBXO8 293 Cell Lysate | +Inquiry |
Thymus-580M | MiniPig Thymus Lysate, Total Protein | +Inquiry |
Colon-780D | Dog Colon Membrane Lysate, Total Protein | +Inquiry |
PRKAG3-2863HCL | Recombinant Human PRKAG3 293 Cell Lysate | +Inquiry |
CA9-2189MCL | Recombinant Mouse CA9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TIM50 Products
Required fields are marked with *
My Review for All TIM50 Products
Required fields are marked with *
0
Inquiry Basket