Active Recombinant Human TWSG1 Protein (211 aa), His-tagged

• Cat.No.: TWSG1-162T
• Product Overview: Recombinant human Twisted Gastrulation (TSG), produced in HEK 293 cells is a polypeptide chain containing 211 amino acids. A fully biologically active molecule, rhTSG has a molecular mass of 30~33 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 211
• Description: Twisted gastrulation (TWSG1 or TSG) is a cysteine-rich 24 kDa glycoprotein. It is a secreted BMP binding protein that modulates BMP ligand availability in extracellular space. Human TSG shares 98% aa identity with mouse and rat TSG, and 99.5% aa identity with canine, equine, bovine and porcine TSG. Glycosylation and bioactivity of TWSG1 recombinant proteins vary markedly by cellular source. Non-glycosylated hTWSG1 made in E. coli has both reduced affinity for BMPs, as shown by surface plasmon resonance analysis, and reduced BMP inhibitory activity in a mandibular explant culture system compared to glycosylated proteins made in insect cells or mouse myeloma cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Determined by its ability to neutralize BMP-6 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The ED50 for this effect is < 2 μg/mL of TSG.
• Molecular Mass: 30-33 kDa, observed by reducing SDS-PAGE.
• AA Sequence: HHHHHHHHCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Human Twisted Gastrulation (TSG), remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Twisted Gastrulation should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: TWSG1 twisted gastrulation homolog 1 (Drosophila) [ Homo sapiens ]
• Official Symbol: TWSG1
• Synonyms: TWSG1; twisted gastrulation homolog 1 (Drosophila); twisted gastrulation protein homolog 1; TSG
• Gene ID: 57045
• mRNA Refseq: NM_020648
• Protein Refseq: NP_065699
• MIM: 605049
• UniProt ID: Q9GZX9