Recombinant Full Length Ashbya Gossypii Iron-Sulfur Clusters Transporter Atm1, Mitochondrial(Atm1) Protein, His-Tagged
Cat.No. : | RFL10914AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Iron-sulfur clusters transporter ATM1, mitochondrial(ATM1) Protein (Q751N2) (23-691aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-691) |
Form : | Lyophilized powder |
AA Sequence : | STHPYHVTAPRMWGTRMPLQLQASLRPNNAVEKGISGDVKVAGAMVKPAASGGESAKSKT PTVSELKILKDLFRYIWPRGDRKVKTRVLIALGLLLGSKLLNVQVPFFFKSTVDSMNIEW GDVGTALPIAVTLTVLSYGAARFGAVLFVELRNAVFSNVAQSAITKVSLQTFQHLMKLDL GWHLSRQTGGLTRAMDRGCKGISYVLSAMVFHIIPITFEISMVCGILTYQFGASFAAITF STMLLYSIFTFRTTAWRTRFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHT SLMKYRDSQIKVSQSLAFLNTGQNLIFTTALTAMMYMACNGVMQGSLTVGDLVLINQLVF QLSVPLNFLGSVYRDLKQSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTF GYDPERRILNNVSFTIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDL DLLSLRKAIGVVPQDTPLFNDTIWENVKFGNISSSDDEILRAIEKAQLTKLLQNLPKGAS TVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNS KTSVYVAHRLRTIADADKIIVLEQGSVREEGTHSSLLASQGSLYRGLWDIQENLTLPERP EQSTGSQHA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATM1 |
Synonyms | ATM1; AGL335W; Iron-sulfur clusters transporter ATM1, mitochondrial |
UniProt ID | Q751N2 |
◆ Recombinant Proteins | ||
B9D1-500R | Recombinant Rhesus monkey B9D1 Protein, His-tagged | +Inquiry |
RFL11472OF | Recombinant Full Length Oncorhynchus Nerka Nadh-Ubiquinone Oxidoreductase Chain 3(Mt-Nd3) Protein, His-Tagged | +Inquiry |
DUSP21-12212H | Recombinant Human DUSP21, His-tagged | +Inquiry |
LEO1-2081HFL | Recombinant Full Length Human LEO1 Protein, C-Flag-tagged | +Inquiry |
TREM1-1779R | Recombinant Rhesus Monkey TREM1 Protein | +Inquiry |
◆ Native Proteins | ||
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
HSV1-15 | Native Herpes Simplex Virus (HSV) Type 1 Antigen | +Inquiry |
PLC-30 | Active Native Phospholipase C | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
◆ Cell & Tissue Lysates | ||
Olfactory (region)-37H | Human Olfactory (Region) Tissue Lysate | +Inquiry |
FAM83F-269HCL | Recombinant Human FAM83F lysate | +Inquiry |
CHMP1B-7533HCL | Recombinant Human CHMP1B 293 Cell Lysate | +Inquiry |
CDC20B-319HCL | Recombinant Human CDC20B cell lysate | +Inquiry |
TNFRSF17-2489HCL | Recombinant Human TNFRSF17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATM1 Products
Required fields are marked with *
My Review for All ATM1 Products
Required fields are marked with *
0
Inquiry Basket