Recombinant Full Length Emericella Nidulans Iron-Sulfur Clusters Transporter Atm1, Mitochondrial(Atm1) Protein, His-Tagged
Cat.No. : | RFL32569EF |
Product Overview : | Recombinant Full Length Emericella nidulans Iron-sulfur clusters transporter atm1, mitochondrial(atm1) Protein (Q5B1Q2) (18-721aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Emericella nidulans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-721) |
Form : | Lyophilized powder |
AA Sequence : | VSHRPAFPRSNPVSAALGGTQFRKLSVKTQTDKNTLSDKKTAEADTSSSSSSAKSAAPSQ QKTQNATTAQKNLLSESTVANKEQRKADWAIMREMAKYLWPKGDWGTKLRVGTALSLLVG AKVLNVEVPFYFKSIVDSMNVDFAAVGGTAYTVAGSMIIAYGATRIGATFFQELRNAVFA SVAQKAIRKVARNVFEHLLRLDLNFHLSRQTGGLTRAIDRGTKGISFLLTSMVFHVVPTA LEISLVCGILTHQYGIKFAAITATTMLAYSAFTIATTAWRTKFRKQANAADNRGATVAVD SLINYEAVKYFNNEKFEVARYDKALKAYEDASIKVTTSLAFLNSGQNMIFSSALAAMMYL AADGVATGSLTVGDLVMVNQLVFQLSVPLNFLGSVYRELRQSLLDMETLFNLQKVNVNIK EKPDAKPLELKQGGQIRFENVTFGYHPERPILKNASFTIPAGQKFAIVGPSGCGKSTILR LLFRYYDVQEGRILVDGQDIRHVTIESLRKAIGVVPQDTPLFNDTIEHNIRYGRLDASDE EVRKAARRAHIHELVERLPEGYRTAVGERGMMISGGEKQRLAISRLLLKDPQLLFFDEAT SALDTYTEQALMQNINSILKEKGRTSVFVAHRLRTIYDCDQILVLKDGQVAELGSHRELL DLDGIYAELWSAQETSLAQDPEYERNAGLEGETAGEVEDKAPRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | atm1 |
Synonyms | atm1; AN5528; Iron-sulfur clusters transporter atm1, mitochondrial |
UniProt ID | Q5B1Q2 |
◆ Recombinant Proteins | ||
FGF8a-2146H | Active Recombinant Human FGF8a protein | +Inquiry |
RFL14942MF | Recombinant Full Length Mouse Ubiquitin-Associated Domain-Containing Protein 2(Ubac2) Protein, His-Tagged | +Inquiry |
NTRK1-717H | Recombinant Human NTRK1, GST-His | +Inquiry |
HCV-03 | Recombinant HCV NS3 protein, His-tagged | +Inquiry |
TFRC-2179H | Recombinant Human TFRC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
CP-8075R | Native Rat Serum Ceruloplasmin | +Inquiry |
Thrombin-30B | Active Native Bovine alpha-Thrombin-BFPRck, Biotin-tagged | +Inquiry |
REN-245H | Active Native Human Renin | +Inquiry |
Neuraminidase-013C | Active Native Clostridium perfringens Neuraminidase Agarose, Type VI-A | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCPS-7046HCL | Recombinant Human DCPS 293 Cell Lysate | +Inquiry |
RPS6KC1-2157HCL | Recombinant Human RPS6KC1 293 Cell Lysate | +Inquiry |
COX19-7335HCL | Recombinant Human COX19 293 Cell Lysate | +Inquiry |
PRDX5-2878HCL | Recombinant Human PRDX5 293 Cell Lysate | +Inquiry |
KCNK2-96HCL | Recombinant Human KCNK2 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All atm1 Products
Required fields are marked with *
My Review for All atm1 Products
Required fields are marked with *
0
Inquiry Basket